KEGG   Ruegeria pomeroyi: SPO0857Help
Entry
SPO0857           CDS       T00215                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sil00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sil00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
907689..908624
Genome map
AA seq 311 aa AA seqDB search
MLEGGDVSVAILNRGCITQDWQVPLRGTRVPVVLGYADPADYAHNPAYLGVIAGRVANRI
SGAAFTLDGQRYDLPANEAPNHIHGGPEGLHTRLWEMEADGARAVRLTLVSPHGEGGYPG
RLDLTVTIRLEGDALTYDIRAVSDRPTLLNLAQHSYYSLGAETCRDFHVTLPASRHTPND
AARIPTGEIVPVTDRPFDFRNGRSIAEADPERQGLDMNFVLDRGQARVTGNGLVLEIETD
QPCLQLYSGQHLNPLHPPLPGQSHAPFAGLCLEPQGYPNAVNTPGFPCPLVTPDHPYRQR
TTVRIREQDAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgctggaggggggcgacgtttcggtcgcgatcctgaaccgtggctgtatcacccaggac
tggcaggtgccgctgcgtggcacccgggtgccggtggtgctgggctatgccgaccctgcc
gactacgcccataaccccgcctatctcggggtgattgcgggccgggtggccaaccgtatt
tcgggcgcggcgttcacgctggacgggcagcgctatgacctgcccgccaacgaggcgccg
aaccacatccacggcgggccagaggggctgcatacgcgcctgtgggagatggaggcggac
ggtgcccgcgcggtgcgcctgacactggtgtccccacatggcgagggcggataccccggg
cggctcgatctgacggtgaccatccggctggaaggtgacgcgctcacctatgacatacgt
gccgtcagcgaccgtccgaccctgctgaacctggcgcagcattcctattattcgcttggg
gccgagacctgccgcgatttccacgtgaccctgcccgccagccgccataccccgaatgac
gccgccaggatccccaccggcgaaattgtcccggtcaccgatcgccccttcgactttcgc
aacgggcgcagcatcgccgaggcggacccagagagacaggggctggacatgaatttcgta
ctcgaccgggggcaggcgcgggtgaccggcaacgggctggtgctggagatcgagaccgac
cagccctgcctgcaactctatagcggtcagcacctgaacccgctgcacccccccttgccg
ggccagagccacgcgccctttgcgggcctctgtctggagccgcagggctatcccaacgcg
gtgaacacccccggctttccctgcccgctggtcacccccgatcacccctaccgccagcgc
acgacagtgcgcatacgcgaacaggacgcggcatga

DBGET integrated database retrieval system