KEGG   Ruegeria pomeroyi: SPO0864Help
Entry
SPO0864           CDS       T00215                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPO0864
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO0864
   00052 Galactose metabolism
    SPO0864
   00500 Starch and sucrose metabolism
    SPO0864
   00520 Amino sugar and nucleotide sugar metabolism
    SPO0864
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPO0864
   00524 Butirosin and neomycin biosynthesis
    SPO0864
Enzymes [BR:sil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPO0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916075..916998
Genome map
AA seq 307 aa AA seqDB search
MTVLVADVGGTNTRVALASAGQLVHLARFANDAYGSFAEVLTAYARGRDLPGLRGVCVAV
AGPVANGRAELTNRNWHFDTAELAAPLPGQGDVAARLINDLVALGHALPGLTAAQLDVIR
AGAVQPSNDQALVAGLGTGFNTCLLKGGAVVEAELGHASLPLAIAEELRAQLGDAAGGFR
TNECLFSGRGLSRLHAILSGQDRRGQDILADYAIGEDPQAAATVTLTARLLGLFARELVF
QYLPFRGIHFAGGAARGILGSAARAEFLSAFEADGRFADHLDRVPVRLIADDAAALSGAA
RLMEECA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctggtggcagatgtggggggcaccaatacccgcgtcgcgctggccagcgcc
gggcagctggtgcatctggcccggttcgccaacgatgcctatggctctttcgccgaggtg
ctgacggcctatgcgcggggcagggacctgccgggtctgcgcggcgtctgtgtcgcggtg
gcgggcccggtggcgaatgggcgcgccgagctgaccaaccggaactggcatttcgatacg
gcagagctggccgcgccgctgccagggcagggcgatgttgcggcgcggctgatcaacgat
ctggtggcgctgggccatgccttgccggggctgacggcagcgcagcttgacgtgatccgc
gcgggcgccgtacagccttcgaacgatcaggcgctggtggccgggctgggcaccggtttc
aacacctgcctgctcaagggtggcgcggtggtcgaggcggaactgggccatgccagcctg
ccgctggccatcgccgaggaactgcgcgcgcagcttggcgacgcggcgggcgggtttcgc
accaacgaatgcctgttctcgggccggggcctgtcgcggctgcatgccatcctgtccggt
caggaccggcgcggacaggacatcctggcggattatgcaattggcgaggacccgcaggcc
gccgccacggtgactctgaccgcgcggctcttgggtctgttcgcccgcgaactggtgttt
cagtacctgccgtttcgcggcatccactttgccggcggggccgcgcgcggcatcctcggc
tcggcggcgcgcgccgaattcctgtcggccttcgaggccgatgggcggtttgccgaccat
ctggaccgggtaccggtgcggctgatcgccgacgatgccgcagcgctcagcggcgcagcg
cgactgatggaggaatgcgcatga

DBGET integrated database retrieval system