KEGG   Ruegeria pomeroyi: SPO1000Help
Entry
SPO1000           CDS       T00215                                 

Gene name
soxE
Definition
diheme cytochrome c SoxE
Orthology
K08738  
cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sil00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sil02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1052039..1052749
Genome map
AA seq 236 aa AA seqDB search
MRWLGGAILAGAALTGVARADETARDIGDAARGEELFQVCASCHQVGEGAEHGTGPHLNG
IFDRKVAQFEDFDYSPGILRARRDGMVWDLEHLDAYLTNPKTLVSGTNMDFAGLPDPQDR
GDILAYLRRFSASPQNIPEAAPTALKQDVELAPEVLAMVGDPEYGEYLSTECTTCHQVDG
EYDGIPVITGWLAEDFVLAMHAYKLKIRPHPVMQMMAGRLSDEEIAALAAYFEALE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggctgggaggagcgatactggccggggccgccctgacgggggtggcccgggcc
gacgagaccgcgcgtgacatcggcgatgccgcgcgcggggaggagctgtttcaggtctgt
gccagctgtcaccaggtgggcgagggggccgagcacggcaccgggccgcatctgaacggc
atcttcgatcgcaaggtcgcccagttcgaggatttcgactattccccgggcatcctgcgc
gcccggcgcgacgggatggtctgggatctcgaacatctcgatgcctatctgaccaatccc
aagaccctggtctcgggcaccaacatggacttcgcgggcctgcctgatccgcaggaccgc
ggcgacatcctggcctatctgcgccggttctcggccagtccccagaacatccccgaggcg
gcgcccactgctctgaaacaggatgtggaactggcacccgaagtgctggccatggtgggc
gatcccgaatatggtgaatacctgtccaccgaatgcaccacctgccatcaggtcgatggc
gagtatgacggcattccggtgatcaccggctggctggccgaggatttcgtccttgccatg
catgcctacaaactgaagatcaggccacacccggtgatgcagatgatggccgggcggctg
tcggacgaggagatcgcggccctggcggcctatttcgaagcgctggagtaa

DBGET integrated database retrieval system