KEGG   Ruegeria pomeroyi: SPO1182Help
Entry
SPO1182           CDS       T00215                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sil  Ruegeria pomeroyi
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sil00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sil00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1234460..1235941
Genome map
AA seq 493 aa AA seqDB search
MGDTRRRLSQLALTARGGRDPDISGLAVDSRLVREGFLFAALPGSRVHGGDFIQYALRMG
ASAILTDAEGARIAAAELAASQAALVVVEDPRQTLALTAALWFGAQPATMVAVTGTNGKT
SVSTFVRQIWTELGHDAVNLGTTGVEGAWTAPLAHTTPEPITLHRCLAEAVANGVTHAAM
EASSHGLEQRRLDGVVLKAAGFTNFTQDHLDYHETFEAYFAAKAGLFRRVLPPDGVAVIN
MDDPKGAEMRAIAAARGQNVLTVGRGPCDLSLTNQRFDATGQDLLFSWRGKAYQARLDLI
GGFQAENILLACGLVIASGGAPERVFETLPHLGTVRGRMQLAATRANGAAVFVDYSHTPD
AVATALRALRPHVMGRLVAIVGAGGDRDPYKRPLMGKAAVENADIVIITDDNPRSEDPAL
IRAAVMQGAPGATEVGDRAEAILRGVDTLEPGDALLICGKGHETGQVVGDQVLPFDDVEQ
ASIAVAALEGRLA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacgcgacgcagactgagccaactggcgctgaccgcccggggcgggcgtgac
cccgatatttcggggctggcggtcgacagccgtctggtgcgcgaggggttcctgttcgcg
gccctgcccggcagccgggtgcatggcggagacttcatccaatacgccctgcggatgggc
gcaagcgccatcctgaccgatgccgagggcgcccgtatcgcggccgccgaactggccgcc
tcgcaggcggcgctggtggtggtcgaggacccgcgccagacgctggccctgacggccgcg
ctgtggttcggggcgcagcctgccaccatggtcgcggtcaccggcaccaatggcaagacc
tcggtttcgaccttcgtgcgccagatctggaccgagctgggccatgatgcggtcaacctc
ggcaccaccggggtcgagggcgcctggaccgcgccgctggcccataccacgcctgaaccg
atcaccctgcatcgttgtctggccgaggcggtcgcaaacggggtcacccatgcggcgatg
gaggcctccagccacgggctggaacagcggcggctcgatggggtggtgctcaaggctgcc
gggttcaccaatttcacccaggaccatctggattatcacgaaaccttcgaggcctatttc
gcggccaaggcggggctgttccgccgtgtgctgccgcctgacggggtggccgtgatcaac
atggacgaccccaagggcgccgagatgcgcgccattgccgccgcgcgcggccagaacgtg
ctgaccgtcgggcgcggcccctgcgatctgagcctgaccaaccagcggttcgacgccacc
gggcaggacctgttgttctcgtggcggggcaaggcctatcaggcgcggcttgacctgatc
ggcggtttccaggcggaaaacatcctgttggcctgcgggctggtcatcgccagcggcggt
gcgcccgaacgggtgttcgaaaccctgccgcatctgggcactgtccggggccggatgcag
ttggccgcaacccgcgccaatggcgcggcggtctttgtcgattactcccatacgcctgat
gcggtcgccactgcgctcagggcgctgcgcccgcatgtgatggggcgtctggtggccatc
gtcggtgccggcggcgaccgtgacccgtacaagcgcccgctgatgggaaaggctgcggtg
gaaaatgccgatatcgtcatcatcaccgatgacaatccgcgcagcgaggaccccgccctg
atccgcgccgccgtgatgcagggcgcccccggtgccaccgaagtgggcgatcgggccgag
gcgatcctgcgcggtgtcgacacgctggaacccggcgatgccttgctgatctgcggcaag
ggacatgagaccgggcaggttgtgggcgaccaggtgctgccctttgacgatgtggaacag
gccagcatcgcggtggccgcactggaaggacggctggcatga

DBGET integrated database retrieval system