KEGG   Ruegeria pomeroyi: SPO1363Help
Entry
SPO1363           CDS       T00215                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sil  Ruegeria pomeroyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sil00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
1428875..1429669
Genome map
AA seq 264 aa AA seqDB search
MGQAHLMGILNVTPDSFSDGGRHFGIEAARRVALEMVAQGVSLLDVGGESTRPGALEVPA
EDEIHRTAPVIEAIRAETGTAISIDTRKASVAEAALAAGASLVNDVSGFTFDAALAPLCA
ETRTPVCIMHAQGDPATMQQDPHYDDVLLDVYDFLAAQVDRLVARGMARGQIVIDPGIGF
GKTQDHNLTLLRNLSLFHGIGCPILLGVSRKRFIGTIGKEPRAQARGPGSISVGLAGLAQ
GVQILRVHDVAETAQALRLWAAVR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggcgcatctgatgggtatcctcaacgtcacgcccgacagtttctcggacgga
ggacgccatttcgggatcgaggccgcccgccgcgtcgcgctggagatggtggcgcagggg
gtcagcctgctggatgtggggggggaatcgacccggcctggcgcgctcgaagtgcccgcc
gaggacgaaatccatcgtaccgcaccggtgatcgaggcgatccgggccgagaccggcacc
gccatttcgatcgacacccgcaaggccagcgtggccgaggcggcgctggccgccggtgcc
agcctggtgaacgatgtgtcggggtttacctttgacgccgctttggcgccgctctgcgcc
gagacgcgaacaccggtgtgcatcatgcatgcgcagggcgatccggcgaccatgcagcag
gacccgcattacgatgatgtcctgctcgatgtgtatgattttctggccgcacaggtggac
cggctggtcgcgcggggcatggcgcgcggtcagatcgtgatcgacccgggtatcgggttc
ggcaagacgcaagaccacaatctgaccctgctgcgcaacctgtcgctgtttcacggtatc
ggctgcccgatcctgctcggggtctcgcgcaagcgcttcatcggcaccatcggcaaggaa
ccgcgcgcgcaggcgcgcgggccgggctcgatttccgttggtttggcggggcttgcgcag
ggggtccagattttgcgcgtgcatgacgtggccgaaacggcacaggccttgcgcctgtgg
gccgccgtccggtaa

DBGET integrated database retrieval system