KEGG   Ruegeria pomeroyi: SPO1414Help
Entry
SPO1414           CDS       T00215                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPO1414
Enzymes [BR:sil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPO1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1485525..1486487)
Genome map
AA seq 320 aa AA seqDB search
MTLTPAPLFEDVAGGPAGGAAHWMQTSDGLRIRAGHWRPEGEVRGTVLMFPGRTEYVEKY
GNAAQAFVTRGFAMLAVDWRGQGLADRLLEDRRLGHVLEFTDYQRDVAAVVELATTLDLP
RPWFVVGHSMGGAIGLRAVMEGLPVAACAFTGPMWGIFFTPVMKPLSWITANLAPAIGMG
HKHPATTTLEPYVQAQEFEGNSLTRDPAMYEMMRSQLAAHPELALGAPTNIWLREALAEC
RALSDRPSPDLPCLTFLGSHEQIVDRKAVRARMARWPRGELVEIPDGEHEVLMEAPEVRD
PAYDRMAALFSAPDQLQRSA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacgccggcccccctgttcgaagatgtggccggcggccccgccggtggcgcg
gcccattggatgcagaccagcgacgggctgcgcatccgtgccggtcactggcgccccgag
ggcgaggtacgcggcaccgtgctgatgtttcccgggcgcaccgaatatgtcgagaaatac
ggcaatgcggcgcaggcctttgtgacgcgcggctttgccatgctggcggtggactggcgc
ggccagggcctggccgaccggctgctggaggaccggcgcctgggccatgtgctggagttc
accgattaccagcgcgacgtggcggcagtggtggaactggccaccacgctggacctgccc
agaccctggttcgtggtcggccattccatgggcggcgccatcgggctgcgcgcggtgatg
gaggggctgccggtggcggcctgcgcctttaccggcccgatgtggggcattttctttacc
ccggtgatgaagccgctgagctggatcaccgccaacctcgctccggcgatcggaatgggg
cacaaacatcccgccaccaccacgctggaaccctatgtgcaggcgcaggagttcgagggc
aattcgctgacccgcgacccggcgatgtacgagatgatgcgcagccagctggccgcgcat
ccggaactggcacttggggcgcccaccaatatctggctgcgcgaggcgctggccgaatgc
cgtgcactcagcgatcgcccctcgcccgatctgccctgcctgacctttctgggcagccat
gagcagatcgtcgaccgcaaggcggtgcgcgcccgcatggcgcgctggccgcgcggcgag
ctggtcgagatcccggacggcgaacacgaggtgctgatggaggcccccgaggtgcgtgac
ccggcctatgaccggatggcggccctgttctcggcccccgaccagttgcaacgcagcgcc
tga

DBGET integrated database retrieval system