KEGG   Ruegeria pomeroyi: SPO1813Help
Entry
SPO1813           CDS       T00215                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00010  Glycolysis / Gluconeogenesis
sil00620  Pyruvate metabolism
sil00640  Propanoate metabolism
sil00680  Methane metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO1813 (acs)
   00620 Pyruvate metabolism
    SPO1813 (acs)
   00640 Propanoate metabolism
    SPO1813 (acs)
  Energy metabolism
   00680 Methane metabolism
    SPO1813 (acs)
Enzymes [BR:sil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SPO1813 (acs)
Lipid biosynthesis proteins [BR:sil01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SPO1813 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAV95092
UniProt: Q5LSF5
Position
complement(1930432..1932396)
Genome map
AA seq 654 aa AA seqDB search
MSPAAQTETKLYAPSADTVARAHVNADTYDRMYAASMADPEGFWAEQGKRVDWIKPFTQV
KDVNYNFGEVSINWYADGTLNVAANCIDRHLATRGDQTAIIWEPDSPTEAAKHITYKELH
GSVCRMANILESLGVRKGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALAAR
VNGCDAKVVITADEAPRGGRKTPLKSNADAALLHCKDTVKCLVVKRTGGQTTWIADRDFD
YNEMALEASDYCAPAEMGAEDPLFILYTSGSTGQPKGVVHTTGGYLVYAAMTHEITFDYH
DGDIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWEVCAKHKVNQFYT
APTAIRALMGQGTSFVEKHDLSDLRLLGTVGEPINPEAWNWYNEVVGKGKCPIVDTWWQT
ETGGHLMTPLPGAHATKPGAAMKPFFGVVPVVLDPQSGVEISGNGVEGVLCIKDSWPGQM
RTVWGDHERFQKTYFADYKGYYFTGDGCRRDAEGDYWITGRVDDVINVSGHRMGTAEVES
ALVAHAAVAEAAVVGYPHEIKGQGIYCYVTLMNDREPSDELMKELRSWVRTEIGPIASPD
VIQWAPGLPKTRSGKIMRRILRKIAENDFGSLGDTSTLADPSVVDDLIANRAGK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccagcagctcagaccgagaccaagctctatgcgccatccgccgacaccgtggca
cgtgcgcatgtgaatgcggacacctatgaccggatgtatgccgcctcgatggccgatccc
gaggggttctgggccgagcagggcaagcgggtcgactggatcaagccctttacccaggtc
aaggacgtcaactacaacttcggcgaggtctcgatcaactggtatgccgatggcaccctg
aacgtcgcggccaactgcatcgaccgtcacctggccacccggggtgatcagaccgcgatc
atctgggaaccggactcccccaccgaagcggccaagcacatcacctataaggagctgcac
ggctcggtctgccggatggccaacatcctggagagcctgggcgtgcgcaagggtgaccgc
gtcgtcatctacctgccgatgatccccgaggcggcctatgccatgctggcctgcgcccgt
atcggcgccatccattccatcgtcttcgccggcttctcgcccgacgcgctggccgcccgg
gtcaacggctgcgacgccaaggtggtgatcaccgccgacgaggcgccgcgcggtggccgc
aagacgccgctgaaatccaatgccgacgccgccctgctgcattgcaaggacacggtcaaa
tgcctggtcgtcaagcgcaccggtggccagaccacctggatcgccgaccgcgactttgac
tataacgagatggcgctcgaggcgtcggattactgcgcccccgccgagatgggcgccgag
gatccgctgttcatcctctacacctccggctcgaccggccaacccaagggcgtggtgcac
accaccggcggctatctggtctatgccgcgatgacgcatgagatcaccttcgactaccac
gacggcgacatctactggtgtactgccgatgtgggctgggtcaccggccacagctatatc
gtctatggtccgctggccaatggcgccaccacgctgatgttcgagggcgtgccgacctat
cccgacgcgggccgtttctgggaggtctgcgccaagcacaaggtcaaccagttctatacc
gcccccaccgccatccgcgcgctgatgggtcagggcaccagctttgtcgaaaagcacgac
ctgagcgatctgcgccttctgggcaccgtgggcgagccgatcaaccccgaggcctggaac
tggtacaacgaggtggtgggcaagggcaaatgcccgatcgtcgacacctggtggcagacc
gagaccggcggccacctgatgacgccgctgccgggcgcccacgcgaccaagccgggggcg
gcgatgaagcccttctttggtgtggtgccggtggtgctcgacccgcaatcgggcgtcgag
atcagcggcaacggggtcgagggcgtgctgtgcatcaaggacagctggccgggccagatg
cgcaccgtctggggcgatcacgagcgcttccagaagacctatttcgccgattacaagggc
tattacttcaccggtgacggctgccgtcgcgatgcggaaggcgattactggattaccggc
cgcgtcgatgacgtgatcaacgtctcgggtcaccgcatgggtaccgccgaggtcgaaagc
gcgctggtcgcccatgccgccgtggccgaggccgccgtggtgggctacccgcacgagatc
aagggccagggcatctattgctacgtgaccctgatgaacgaccgcgagccgtcggacgag
ctgatgaaggagctgcgcagctgggtgcgcaccgagatcggcccgatcgccagcccggac
gtcatccagtgggcgcccggcctgccgaaaacccgttcgggcaagatcatgcgccgtatc
ctgcgcaagatcgccgagaacgacttcggctcgctgggtgacacctcgaccctggccgat
ccctcggtggtcgatgacctgatcgccaatcgcgccggcaagtaa

DBGET integrated database retrieval system