KEGG   Ruegeria pomeroyi: SPO2119Help
Entry
SPO2119           CDS       T00215                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00220  Arginine biosynthesis
sil00330  Arginine and proline metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01130  Biosynthesis of antibiotics
sil01230  Biosynthesis of amino acids
Module
sil_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SPO2119 (rocF)
   00330 Arginine and proline metabolism
    SPO2119 (rocF)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SPO2119 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAV95388
UniProt: Q5LRK8
Position
2253444..2254457
Genome map
AA seq 337 aa AA seqDB search
MTLLYDQNHHWISTRFDQTLAKTATRPHLMSRKTCILIGAPVDSGKRRTGCLMGPDSYRT
AGLAEALADLGHRVEDLGNLSPAEHAPEPSDTHLHQPNRTIGWTNRLIRAAEQAMPRGLP
IFLGGDHALALGSVAGVANHAARVGRPQFVLWLDAHSDYHTPETSASGNLHGTPLGYVTG
RGGFAGFPVIKNPVKQRNICILGLRSVDHAEREALQRTKIRFHDMRQIDEHGIARPLQAF
LDTWAKENGMLHVSLDVDFLDPSIAPAVGTTVPGGATMREGHLVMEMICDSGLMTSLDLV
ELNPFLDERGRTAQLIVDLAASALGRRVFDRPTRSFS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactttgctttatgaccaaaatcaccactggatttcaacacgttttgaccagaccttg
gcgaaaaccgcaacgagacctcatcttatgtcccgcaagacctgtattctgatcggcgcg
cctgtcgacagcggcaagcgccgcaccggatgcctgatgggccccgattcctatcgcacc
gccggcctggccgaggcgctggccgatctgggccacagggtcgaggatctgggcaatctc
tcgcccgccgaacatgcgcccgaaccaagcgacacccacctgcatcagcccaaccgcacc
atcggctggaccaaccggctgatccgcgccgcagaacaggcgatgccgcgcggcctgccg
atctttctgggcggcgatcacgcgctggccctgggcagtgtggcaggcgtggccaaccac
gccgcccgcgtcgggcgcccgcaattcgtgctctggcttgatgcccatagcgattatcac
acgccggaaacctccgcttccggtaacctgcatggcacgccgctgggctatgtcaccggg
cgcggcggctttgccggcttcccggtgatcaaaaacccggtcaagcaacgcaatatctgc
atcctcggcctgcgctcggttgaccacgccgagcgtgaggcgttgcaacgcaccaagatc
cgctttcacgacatgcgacagatcgacgagcatggcatcgcccgccccctgcaggccttt
ctggatacgtgggccaaggagaatggcatgctgcatgtctcgctcgatgtcgactttctc
gacccgtcgatcgcgcctgccgtgggcaccaccgttcccggcggtgccacaatgcgcgaa
gggcatctggttatggagatgatctgcgacagcggcttgatgacctcgctcgacctggtc
gagctgaacccgttcctggatgaacgcggccgcaccgcccaactgatagtcgatctggcc
gcctcggcgctgggccgccgcgtcttcgaccgcccgacgcggagcttctcgtga

DBGET integrated database retrieval system