KEGG   Ruegeria pomeroyi: SPO2119Help
Entry
SPO2119           CDS       T00215                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sil  Ruegeria pomeroyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sil01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sil00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2253447..2254460
Genome map
AA seq 337 aa AA seqDB search
MTLLYDQNHHWISTRFDQTLAKTATRPHLMSRKTCILIGAPVDSGKRRTGCLMGPDSYRT
AGLAEALADLGHRVEDLGNLSPAEHAPEPSDTHLHQPNRTIGWTNRLIRAAEQAMPRGLP
IFLGGDHALALGSVAGVANHAARVGRPQFVLWLDAHSDYHTPETSASGNLHGTPLGYVTG
RGGFAGFPVIKNPVKQRNICILGLRSVDHAEREALQRTKIRFHDMRQIDEHGIARPLQAF
LDTWAKENGMLHVSLDVDFLDPSIAPAVGTTVPGGATMREGHLVMEMICDSGLMTSLDLV
ELNPFLDERGRTAQLIVDLAASALGRRVFDRPTRSFS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactttgctttatgaccaaaatcaccactggatttcaacacgttttgaccagaccttg
gcgaaaaccgcaacgagacctcatcttatgtcccgcaagacctgtattctgatcggcgcg
cctgtcgacagcggcaagcgccgcaccggatgcctgatgggccccgattcctatcgcacc
gccggcctggccgaggcgctggccgatctgggccacagggtcgaggatctgggcaatctc
tcgcccgccgaacatgcgcccgaaccaagcgacacccacctgcatcagcccaaccgcacc
atcggctggaccaaccggctgatccgcgccgcagaacaggcgatgccgcgcggcctgccg
atctttctgggcggcgatcacgcgctggccctgggcagtgtggcaggcgtggccaaccac
gccgcccgcgtcgggcgcccgcaattcgtgctctggcttgatgcccatagcgattatcac
acgccggaaacctccgcttccggtaacctgcatggcacgccgctgggctatgtcaccggg
cgcggcggctttgccggcttcccggtgatcaaaaacccggtcaagcaacgcaatatctgc
atcctcggcctgcgctcggttgaccacgccgagcgtgaggcgttgcaacgcaccaagatc
cgctttcacgacatgcgacagatcgacgagcatggcatcgcccgccccctgcaggccttt
ctggatacgtgggccaaggagaatggcatgctgcatgtctcgctcgatgtcgactttctc
gacccgtcgatcgcgcctgccgtgggcaccaccgttcccggcggtgccacaatgcgcgaa
gggcatctggttatggagatgatctgcgacagcggcttgatgacctcgctcgacctggtc
gagctgaacccgttcctggatgaacgcggccgcaccgcccaactgatagtcgatctggcc
gcctcggcgctgggccgccgcgtcttcgaccgcccgacgcggagcttctcgtga

DBGET integrated database retrieval system