KEGG   Ruegeria pomeroyi: SPO2214Help
Entry
SPO2214           CDS       T00215                                 

Gene name
betC-2
Definition
choline sulfatase (EC:3.1.6.6)
Orthology
K01133  
choline-sulfatase [EC:3.1.6.6]
Organism
sil  Ruegeria pomeroyi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(2353972..2355468)
Genome map
AA seq 498 aa AA seqDB search
MRIPDVKGRPMAVRTRPNILLIMADQMTPFMLEACGGTGARTRHLTRLAGRAVQFTNAYT
PSPICVPARSCFMTGLYTSTTGCYDNGDPYHSFLPTFAHYLTNAGYETVLSGKMHFIGAD
QLHGFQRRLNPDIYPSGFLWSYPLPPDGDASFQAFDFTPQYLAENIGPGWSKELQYDEET
QFRALEYLRHAPDTPWMLTVSFTNPHPPYVVPRPYWEMYKDADIPLPDYPADMDARYSEF
DHALRRWHGLHQRGHEVRDPRNLIAMRRGFAALAHYVDDKIGALLEVLDETGQRDETVII
VTSDHGEMLGEKGLIQKRSLYEWSARIPLIIDLPGAAPGRVDTPVSLLDLPATLIELSGQ
TPVAPLEGRSLLGAVRGQELDTVPIVSEYHGEGIMRPSFMVRLGDWKYHYCHGSAPQLYN
LARDPGEWHNRAGEPDLAETEARLDRVITGGSFDLERIAREVWERLPLKQVVNAAMQRNG
TAWDYRPDPDSGRAYIRS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattcccgatgtgaaagggcgcccgatggcagtacggacacgtcccaacatcctg
ctgatcatggccgatcagatgacgcccttcatgctcgaggcctgcggtggcaccggtgcc
cgcacccgccatctgacccggctggccgggcgcgcggtgcagttcaccaacgcctatacg
cccagcccgatctgtgtgccggcccgatcctgtttcatgaccgggctgtatacttcgacc
accggttgctacgacaacggcgatccctatcacagtttccttcccacctttgcccattac
ctgaccaatgcgggctatgaaacggtgctgtcgggcaagatgcatttcatcggcgccgac
cagttgcacggttttcagcggcgtctcaatcccgatatctacccctcggggttcctgtgg
tcctatccgctgccgcctgacggggacgcctcgttccaggcctttgacttcacgccgcaa
tacctggccgagaatatcggccccggctggtcgaaagagctgcaatacgacgaggaaacc
cagtttcgggcgctggaatacctgcgccacgccccggacacgccctggatgctgaccgtg
tcctttaccaacccgcatccaccctacgtggtgccgcgcccttattgggagatgtacaag
gacgccgatatcccgctgccggactatcccgctgacatggacgcgcgctattccgagttc
gatcacgcgctgcggcgctggcatggcctgcatcagcgcggccacgaggtccgcgacccc
cggaacctgatcgccatgcgacgcggctttgcggcgctggcccattatgtcgatgacaag
atcggtgcgctgctcgaggttctcgacgagaccggccagcgcgacgagacggtgatcatc
gtaacctcggatcatggcgagatgctgggcgaaaaggggctgatccagaaacgcagcctc
tatgaatggtcggcgcgcatcccgctgatcatcgacctgccgggcgccgcgcccggccgg
gtcgacacgccggtgtcgctgctggacctgcccgccacactgatcgaattgtccggtcag
acaccggtggcaccgctagaggggcggtccttgctgggcgcggtgcgggggcaggagctg
gacaccgtgcccatcgtctcggaataccatggcgagggcatcatgcggcccagtttcatg
gtgcggctgggggactggaaatatcactactgccacggttcggcgccgcagctctacaat
ctggcccgggatccgggggaatggcacaaccgggccggagagccggaccttgccgaaacc
gaggcgcggcttgaccgggtgatcaccggcggcagtttcgatctggagcggatcgcgcgc
gaggtctgggagcgtctgcccctcaaacaggtggtcaacgccgccatgcagcgcaatggc
accgcctgggattatcgtcccgacccggattcgggtcgggcctatatacgctcgtga

DBGET integrated database retrieval system