KEGG   Ruegeria pomeroyi: SPO2242Help
Entry
SPO2242           CDS       T00215                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00010  Glycolysis / Gluconeogenesis
sil00020  Citrate cycle (TCA cycle)
sil00620  Pyruvate metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Module
sil_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO2242 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SPO2242 (pdhC)
   00620 Pyruvate metabolism
    SPO2242 (pdhC)
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPO2242 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAV95508
UniProt: Q5LR87
Position
2383575..2384888
Genome map
AA seq 437 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDSVSSGDLLAEIETDKATMEFEAVDEGIVGKIL
VPEGTEGVKVNTPIAVLLDEGESAGDIASASSGATAPSSAPAAASAEKAPQGAAEAPAAA
PAAPKAADGARVFASPLARRIAADKGLDLSQIAGSGPHGRIVKADVIGATAPAAAPASAA
PAPAAAAAPAAAPSGPGADMVARMYEGREYEEVKLDGMRKTIAARLSEAKQTIPHFYLRR
DIKLDALMKFRAQLNKQLEGRGVKLSVNDFIIKAVANALQQVPDCNAVWAGDRVLKLKPS
DVAVAVAIEGGLFTPVLKDADMKSLSALSTEMKDLATRARDRKLAPHEYQGGSFAISNLG
MFGIDNFDAIVNPPHAGILAVGSGVKKPVVGADGELTVATVMSVTMSVDHRVIDGALGAQ
LLQAIVDNLENPMVMLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgaaatcctgatgcccgcgctctctccgaccatggaagaaggcaccctggcg
aaatggctggtcaaggaaggcgacagcgtctcctcaggcgacctgctggccgagatcgag
accgacaaggcgacgatggagttcgaagccgtcgacgaaggcatcgtcggcaagatcctg
gtgcccgagggcaccgagggggtgaaggtgaacacccccatcgcggtcctgctggacgag
ggcgaaagcgcaggcgatatcgccagcgcctcttcgggcgcgaccgcgccctcctcggct
ccagccgccgcctctgccgagaaggccccgcaaggggccgccgaggcacccgccgctgcc
cctgccgcccccaaggcagccgatggcgcccgcgtctttgcctcgccgctggcgcgccgg
atcgccgccgacaaggggctcgatctgtcgcagatcgcaggctccggcccgcatggccgt
atcgtcaaggcggatgtgatcggggccaccgccccggctgcggcgcccgcctctgctgcc
cctgccccggcagccgccgccgctccggccgccgctcccagtggacccggcgccgacatg
gtcgcccgcatgtacgagggccgcgagtacgaagaggtcaagctcgacggtatgcgcaag
accatcgctgcgcgcctgtccgaggccaagcagacgatcccgcatttctacctgcgccgc
gatatcaagctggatgcgttgatgaaattccgcgcccagctgaacaagcagctcgaaggg
cgcggcgtcaagctgagcgtcaacgacttcatcatcaaggcggtcgccaatgcgctgcaa
caggtgcccgactgcaacgcggtctgggccggggaccgggtgctgaagctgaaaccctcg
gacgtggccgttgccgttgccatcgagggcgggctgttcacgccggtgctgaaagatgcc
gacatgaagtcgctctcggcgctgtcgaccgaaatgaaggatctcgccacccgcgcccgc
gaccgcaagctggcgccgcatgaataccagggcggcagctttgccatctcgaacctcgga
atgttcggcatcgacaatttcgacgccatcgtgaacccgccgcatgcgggtatcctggcg
gtcggttccggggtcaagaaaccggtggtcggcgccgatggcgagctgaccgtggccacc
gtgatgtcggtgaccatgtcggtcgatcaccgggtgatcgacggcgcgcttggcgcccag
ctgttgcaagccatcgtcgacaacctggaaaacccgatggtcatgctggcctga

DBGET integrated database retrieval system