KEGG   Ruegeria pomeroyi: SPO2456Help
Entry
SPO2456           CDS       T00215                                 

Definition
peptidyl-prolyl cis-trans isomerase domain-containing protein
Orthology
K03771  
peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
sil  Ruegeria pomeroyi
Brite
Enzymes [BR:sil01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPO2456
Chaperones and folding catalysts [BR:sil03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    SPO2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2610041..2611279
Genome map
AA seq 412 aa AA seqDB search
MQQNLTTLSRCLARMMGAAALTLTLAGGPVAAQSLFSPAIRVNQGVITHFELEQRIRLME
VLRIPGDPQKDARRSLIEEALKMQAVEEAGIEVAPEDVQLGIDDFAARARLSTDEFLAAL
ANEGVSAETVRDFVSKQMAWRDYVSARFLARARPTPDEIDRALGLGGGGGLQVLLSEIII
PITPQTVDQVDEVAQQIAALTSYEAFSSAAIQVSAAETRENGGRMPWIPLAQLPPALQPV
ILELEPGEISDPITLPNAVALFQMRGLREAAVGTPRYAAIDYAAYRMAGGRSPETLKAAT
ELRQRVDTCDDLYGVAKGQPAEVLERISAKPAEIPQDIALELAKLDPGETSLALTRNNGQ
TLLFLMMCTRTRDLGGDASREDVANALTQQRLQTLAESLVEQLRADAIITEE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacctgaccaccctgtcccgatgcctggcccgtatgatgggcgccgccgcg
ctgaccctgacgctggccggtggccccgttgcggcgcaaagcctgttcagcccggcgatc
cgcgtcaatcagggcgtgatcacccatttcgagctggaacagcgcatccgcctgatggag
gtgctgcgcatccccggcgatccgcagaaagacgcccgccgctccctgatcgaggaagcg
ctcaagatgcaggcggtcgaagaggccggcatcgaggtcgcccccgaggacgtgcagctg
ggcatcgacgatttcgccgcccgcgcgcggctgtccacggacgagttcctggcggctctg
gccaacgagggggtctcggccgaaacggtgcgcgatttcgtcagcaagcagatggcctgg
cgcgactatgtcagcgcccgtttcctggcccgcgcccgccccaccccggacgagatcgac
cgcgcgctgggtctgggcggcggcggtggcttgcaggtgctgctctccgagatcatcatc
ccgatcaccccgcagaccgtggatcaggtcgacgaggtggcccaacagatcgccgcgctg
accagttacgaggccttctccagcgccgcgatccaggtctcggcagccgaaacgcgcgag
aatggcggccgcatgccctggatcccgctggcacaactgcccccggcgctgcaaccggtg
atcctcgagcttgagccgggcgagatctccgacccgatcaccctgcccaatgcggtggcg
ctgttccagatgcgcggcctgcgcgaggccgccgtgggcacgccgcgctatgccgcgatc
gactatgccgcctatcgcatggcgggcgggcgcagccccgagacgctgaaggccgcaacc
gagctgcgccagcgcgtcgatacctgcgacgacctctatggcgtggccaagggccagccg
gccgaggtgctggagcggatcagcgccaaacccgcggagatcccgcaggatatcgcgctg
gaactggccaagctggacccgggcgaaacctcgctggcgctgacccgcaacaatggccag
accctgttgttcctgatgatgtgcacccgcacccgcgatctgggcggcgatgcctcgcgc
gaggatgtggccaacgccctgacccagcagcgcctgcagaccctggccgaaagcctggtg
gaacagctgcgcgccgacgccatcatcaccgaggaatag

DBGET integrated database retrieval system