KEGG   Ruegeria pomeroyi: SPO2464Help
Entry
SPO2464           CDS       T00215                                 

Gene name
speB-2
Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
sil  Ruegeria pomeroyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPO2464 (speB-2)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     SPO2464 (speB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(2616800..2617747)
Genome map
AA seq 315 aa AA seqDB search
MSDFNQPIGGNDLARFSGPNTFMRLPQAQALDGLDVAILGIPMDIGTSWRSGTRFGPKQI
RAESAMIRPYNMATGAAPFDSLQIADIGDLAINTFSLADSLRIIKESYDAILTHDVIPVA
MGGDHSITLPILRAIAARHGPVALVHVDAHADVNDQMFGERETHGTVFRRAYEEGLIQPD
KTYQIGIRGSGYAATDFTEAQGWGFQQFPAWELWHKSLVNLGTEIRRDIGDRPVYVTYDI
DSLDPAYAPGTGTPEIGGLTTPQALELIQSLRGLKIVGCDLVEVSPPYDTSGNTALTAAN
LLYELLCVLPGVQAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttcaaccagcccatcggcggcaatgatctggcccggttctcggggccgaat
accttcatgcggctgccgcaagcgcaggcccttgatgggctggatgtggccattctgggg
attccgatggatatcggcacctcgtggcgctcgggcacacggttcgggccgaaacagatc
cgggcggaaagcgcgatgatccggccctataacatggcgacgggcgcggcgccgttcgac
agtttgcagatcgccgatatcggcgatctggcgatcaacacgttttcgctggccgacagc
ctccgcatcatcaaggagagctatgacgcgatcctgacccatgacgtgatcccggtggcg
atgggaggggaccattcgatcaccctgccgatcctgcgcgccatcgcggccagacatggc
ccggtggcgctggtgcatgtagatgcccatgcggatgtgaacgaccagatgtttggcgag
cgtgaaacccacggcaccgtgttccgccgcgcctatgaggaagggctgatccagcccgac
aagacctatcagatcggcattcgcggctcgggctacgccgccaccgattttaccgaggcg
cagggctggggctttcagcagttcccggcctgggagctgtggcacaagtcgctggtcaat
ctgggcaccgagattcgccgcgatatcggcgaccgtccggtctatgtcacctatgatatc
gacagtctggatcccgcctatgcaccgggcacgggcacgcccgagatcggcgggctgacc
acgccgcaggcgctggagctgatccagtcgctgagggggctgaagatcgtcggctgcgat
ctggtcgaggtgtcgcccccctatgacacctcgggcaataccgcgctgaccgcggccaac
ctgctttatgaactgctctgcgtgctgcccggcgtgcaggcgcgctga

DBGET integrated database retrieval system