KEGG   Ruegeria pomeroyi: SPO2621Help
Entry
SPO2621           CDS       T00215                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPO2621 (tpiA)
   01230 Biosynthesis of amino acids
    SPO2621 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO2621 (tpiA)
   00051 Fructose and mannose metabolism
    SPO2621 (tpiA)
   00562 Inositol phosphate metabolism
    SPO2621 (tpiA)
Enzymes [BR:sil01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPO2621 (tpiA)
Exosome [BR:sil04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPO2621 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPO2621 (tpiA)
  Exosomal proteins of melanoma cells
   SPO2621 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
2776049..2776804
Genome map
AA seq 251 aa AA seqDB search
MRRKLAAGNWKMNGTGAALDALEAIAGAHSAAAVDLLICPPATLLYRAAQVAEGSRVRIG
GQDCHAVTAGAHTGDISAMMLADAGASAVILGHSERRADHGETDAQVCDKARAALEAGLI
AIICIGETLAQREAGQTLDVVCAQLAGSVPDGIDGTRVVVAYEPVWAIGTGLVPTLEQIA
EVHDTLRQQLIGRFGSETAEAIRLLYGGSVKPGNAAEIFAVSNVDGALVGGASLTAADFS
PIVSALEQAAG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaaacttgcagcagggaactggaagatgaacggcaccggcgccgcgctcgac
gcgctggaggcaattgccggggcgcattccgccgccgctgttgatctgctgatctgtccg
cccgccacgctcctttaccgcgctgcacaggtcgcagaaggcagccgggtgcggatcggc
ggccaggattgccacgccgtcaccgcaggtgcccataccggcgatatcagcgccatgatg
ctagccgacgccggtgccagcgccgtcatccttggccattccgaacgccgcgccgatcat
ggcgagaccgacgcgcaggtctgcgacaaggcgcgcgcggcgcttgaggccgggctgatc
gccatcatctgcatcggcgagaccctggcccagcgcgaggcgggccagacgctcgacgtg
gtctgcgcgcaactggccggttcggtgcccgacgggatcgacggcacccgggtcgtggtc
gcctatgagccggtctgggccatcggcaccgggctggtgccgacgctggaacagattgcc
gaggttcacgacaccctgcgccagcagctgatcgggcggttcgggtcggagaccgccgag
gcgatccgcctgctttatggcggctcggtcaagccgggcaacgcggccgaaatctttgcg
gtttcgaacgtggatggcgcgctggtcggcggcgccagcctgactgccgccgatttctcg
cccatcgtcagcgcgctggaacaggcggcgggctga

DBGET integrated database retrieval system