KEGG   Ruegeria pomeroyi: SPO2657Help
Entry
SPO2657           CDS       T00215                                 

Definition
(RefSeq) ACC deaminase/D-cysteine desulfhydrase family
  KO
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
sil  Ruegeria pomeroyi
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPO2657
Enzymes [BR:sil01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     SPO2657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2812165..2813322
Genome map
AA seq 385 aa AA seqDB search
MGSMQIRHYSNRFLLSTLRKNMPIQGGIVKTFVDAPVSGAVDDQALLRRALERFARIRLG
HLPSPLEPLDRLSEALGGPRIWVKRDDCTGLSSGGNKTRKLEFLMASACEAGADTIITQG
AIQSNHARQTAAAAARLGLHCHLLLEDRTGAADLAYTLNGNVLLDRLHGATISRRAGGSD
MAAEMERLAATLRGKGKRPYVIPGGGSNRVGALGYVNCALELSEQALSMGLDIDALIHAT
GSCGTQAGLVAGLAGLSWNTHLLGIGVRAPQERQEAMVFDLACETMDYLGMGIPIVRSGV
RANCDHVGPGYGLPTEAMCEAVRMLARLEGLLLDPVYTGKAMAGLIDLTRQGYFDGMANI
VFLHTGGSAALFGYPEIFGLPGYQP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatgcaaattcggcattattcaaaccgatttctcctctctaccctgagaaaa
aatatgccaatccaggggggcatcgtgaagacgtttgtggatgcgcccgtttcaggggcg
gtggacgatcaggcattgctgcgccgcgcattggagcggttcgcgcgtatccgcctgggg
catctgccgagtccgctggaaccgctggaccggctgagcgaggcgcttggcggtccgcgc
atctgggtcaagcgcgacgactgcaccggcctgtccagcggcggcaacaagacccgcaag
ctggaattcctgatggcaagcgcgtgcgaggccggcgccgacacgatcatcacccagggc
gcgatccagtccaaccatgcccgccagaccgccgccgccgcggcgcggctgggcctgcat
tgccacctgttgctggaagaccggaccggcgccgcggacctggcctataccctgaacggc
aatgtgctgcttgaccggttgcacggcgccacgatctcgcgacgggccggcgggtcggac
atggcggccgagatggagcggctggccgcgacgttgaggggcaagggcaagcgcccctat
gtcattcccggcggcggatcgaaccgggtgggtgcccttggctatgtcaattgcgcgctg
gaactgagcgaacaggccctgagcatgggcctggacatcgacgcgctgatccatgcgacg
ggcagttgcggcacgcaggccggcctggtcgcgggcctggccggcctgtcctggaacacc
catctgctggggatcggcgtgcgcgcgccgcaggagcggcaagaggccatggtctttgat
ctggcctgcgagaccatggattaccttggcatgggaataccgatcgtgcgctcgggcgtg
cgggccaattgcgaccatgtcgggccgggctatggcctgccgaccgaggccatgtgcgag
gcggtcaggatgctggcgcggctcgagggtctgctgcttgacccggtctataccggcaag
gccatggcgggcctgatcgacctgacacggcagggatatttcgacgggatggcgaatatc
gtcttcctgcataccggcggcagtgcggcgcttttcgggtatccggaaatcttcggactg
ccgggataccaaccataa

DBGET integrated database retrieval system