KEGG   Ruegeria pomeroyi: SPO2687Help
Entry
SPO2687           CDS       T00215                                 

Gene name
pcm-2
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sil  Ruegeria pomeroyi
Brite
Enzymes [BR:sil01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SPO2687 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_11 Methyltransf_25 Methyltransf_31 RrnaAD GCD14 MTS Methyltransf_23 Methyltransf_32 PrmA Methyltr_RsmB-F Methyltransf_18 DUF938 TehB
Motif
Other DBs
NCBI-ProteinID: AAV95932
UniProt: Q5LQ09
Position
complement(2839026..2839673)
Genome map
AA seq 215 aa AA seqDB search
MSGPDPETKMQFLFALRSKGVTDKRVLAAMEEVDRGLFVRGLFSGRAYEDMPLPIACGQT
ISQPSVVGLMTQALEVNPRDKVLEVGTGSGYQAAILAKLARRVYTVDRHARLVRAAQLVF
QQLQLVNITTMTADGSFGLPDQAPFDRIIVTAAAEDAPGPLLAQLKIGGIMVLPVGQSDT
VQTLIRVRRTEQGFDYDELRPVRFVPLLEGLGKDG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacccgatcccgaaaccaagatgcagttcctgtttgctctccgatccaagggg
gtgaccgacaagcgggtgctggcggcgatggaagaggtggatcgcggcctgttcgtgcgg
ggcctgttttccgggcgcgcctatgaggatatgccccttcccatcgcctgtggtcagacc
atcagccagccctcggttgtcggtttgatgacccaggcgctggaggtcaatccgcgtgac
aaggtgctcgaggtcggtaccggctcgggctaccaggcggcgatcctggcaaagctggcg
cggcgggtctatacggtcgaccgccacgcccggctggtgcgcgcggcgcagctggtgttc
cagcagttgcagctggtcaatatcaccaccatgaccgccgacggatcctttggtctgccc
gatcaggcgccctttgaccgcatcatcgtcaccgccgccgccgaggatgcgcccggcccg
ctcttggcgcagctcaagatcgggggtatcatggttttgcccgtggggcagtcggacacg
gttcagaccctgatccgggtgcgccgcaccgaacagggctttgactatgatgaattgcgc
ccggtccggttcgtgccattgctcgaagggttgggcaaggatgggtga

DBGET integrated database retrieval system