KEGG   Ruegeria pomeroyi: SPO2791Help
Entry
SPO2791           CDS       T00215                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00010  Glycolysis / Gluconeogenesis
sil00620  Pyruvate metabolism
sil00640  Propanoate metabolism
sil00680  Methane metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO2791 (acsA)
   00620 Pyruvate metabolism
    SPO2791 (acsA)
   00640 Propanoate metabolism
    SPO2791 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SPO2791 (acsA)
Enzymes [BR:sil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SPO2791 (acsA)
Lipid biosynthesis proteins [BR:sil01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SPO2791 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF4414
Motif
Other DBs
NCBI-ProteinID: AAV96032
UniProt: Q5LPQ7
Position
complement(2978553..2980085)
Genome map
AA seq 510 aa AA seqDB search
MTFAARIPGLRPDGGWDLPERLNMARQCLSQPAGALAIIDLTGPARRDITHGDLSGMVQG
LARALLPRVAPGDRVGVLLSQSPWCAAAHLALWHIGAISVPLFKLFQQDALRSRLEDAGA
RLVLTDAEGATLLGDLATPLMAAEIGLPGEPVPQADTRPEDPAVLIYTSGTTGRAKGALH
GHRVLTGHLPGVSISHNHLRPGDCLWTPADWAWIGGLFDVLMPGLALGIPVVAARLDKFS
AEACADVIAQGGVRNVFFPPTALRMLKAADQALPGLRSVASGGEPLGAEMLAWGEGAFGL
TINEFYGQTECNMTVSSCAADFPVRPGCIGKPVPGHEVAVIDDTGQPTRGEGDVAVRRGS
ASMLLEYWRNPAATAEKFRGDWLVTGDRGVWEGDYLRFVGREDDVITSAGYRIGPAEIED
CLLTHPGVATVGVVGKPDPLRTEIVKAYVVMKPGARASEEELQTWVKDRLAQYSYPREVA
FLDALPMTVTGKVIRKELKRRAAAELEANP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgcggcgcgcataccggggttgcgccctgatggcggctgggacctgcccgag
cgtctgaacatggcgcgtcagtgcctgtcgcaacctgcgggtgcactggcgatcatcgac
ctgaccgggcccgcgcggcgcgacatcacccatggggacctgtccggcatggtgcagggg
ctggcgcgggcgctgctgccgcgcgtggcgccgggtgaccgggtcggcgtgctgctcagc
cagtcgccctggtgcgcggcggcgcatctggcgctctggcatatcggcgccatttcggtg
ccgctgttcaagctgttccagcaggacgcgctgcgcagccgtctggaggatgcgggcgcg
cggctggtgctgaccgatgccgagggcgcgaccctgctgggcgatctggcgaccccgctg
atggcggccgagatcgggctgcccggcgaaccggtgccgcaggcagatacgcggcccgag
gatccggcggtgctgatctatacgtcgggcaccacgggccgggccaagggcgcgctgcat
ggtcaccgggtgctgaccgggcacctgccgggggtctcgatcagccacaaccacctgcgc
cccggcgattgcctgtggacgcctgccgactgggcctggatcggcggtctgttcgatgtg
ttgatgccggggctggcgctgggcattccggtggtggctgcgcggctggacaagttcagc
gccgaagcctgcgccgatgtgattgcacagggcggggtcaggaacgtgttctttccgccc
accgcgctccgcatgctcaaggcggcggatcaggcgcttcctggcctgcgctcggtcgcc
tcgggcggcgagccgttgggggccgagatgctggcctggggcgagggcgcctttggcctg
acgatcaacgaattctacggccagaccgagtgcaatatgaccgtgtcgtcctgcgccgcc
gatttcccggtgcgcccgggctgtatcggcaagccggtgccggggcatgaggtggcggtg
atcgacgacacgggccagcccacaaggggtgagggcgatgtcgccgtgcggcgcggttcg
gcctcgatgctgctggaatactggcgcaacccggcagccaccgccgagaagtttcggggc
gactggctggtgaccggggaccggggcgtgtgggagggcgactacctccgtttcgtgggg
cgcgaggatgacgtgatcacctcggccggctaccgcatcggcccggcggagatcgaggat
tgcctgctgacccatccgggcgttgcgacggtgggcgtggtgggcaagcccgatccgctc
agaaccgagatcgtcaaggcctatgtggtgatgaaacccggcgcccgggccagcgaagaa
gagttgcaaacttgggtcaaggaccggctcgcccaatattcctacccgcgcgaggtggcg
tttctggacgcgctgccgatgacggtgacaggcaaagtgatccgcaaggaattgaagcgc
cgcgcagcggcagaactggaggccaatccatga

DBGET integrated database retrieval system