KEGG   Ruegeria pomeroyi: SPO2956Help
Entry
SPO2956           CDS       T00215                                 

Definition
guanine deaminase
Orthology
K01487  
guanine deaminase [EC:3.5.4.3]
Organism
sil  Ruegeria pomeroyi
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sil00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3155229..3156512
Genome map
AA seq 427 aa AA seqDB search
MTGQTILRGRVLSFVQSPFDTAPETAVRENEALLIEGGHVTAVGSWDALRREAPQAEVSD
HGERVILAGFVDAHVHYPQTAMIASWGKRLIDWLNTYTFPEERKFADLTYASEIAARYLD
LTAAHGTTTMCSFCTIHPESVEAFFAEAQARGQRVVAGKTCMDRNAPDFLRDTAQSAYDQ
SKALLQKWHGVDRISYAITPRFSPTSTSEQLDAMGALWAEHPDCLMQTHLSEQTDEIEWV
KGLYPEARDYLDTYEQHGLLGGCGLYGHAIHLEKRERDRLREHGAGLIHCPTSNTFIGSG
LFDMAGLMAEGQRIGLATDTGGGSSFSMLRTMAAAYEIGQLRGVPLHAAQLLWLATQGSA
RALRMDHQIGNIAPGMEADLVVLDLASTPAIAQRSAMADDLWEALFPTIMMGDDRAIAEV
WIAGRRV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacagaccattttgcgggggcgggtgctgtcctttgtgcagtccccctttgat
accgcgcccgaaacggccgtccgcgaaaacgaggcgctgctgatcgagggcgggcatgtg
acggcggtcggcagctgggacgcgctgcggcgcgaagccccgcaggcagaggtaagtgat
cacggcgaacgggtaattctggccggcttcgtggatgcgcatgtgcattatccccagacc
gcgatgatcgcgagctggggcaagcggctgatcgactggctcaacacctatacctttccc
gaagagcgcaagttcgccgacctgacctatgcctccgagatcgcggcccggtatctggac
ctgacggcggcgcatggcaccaccaccatgtgcagcttctgcaccatccatcccgagagc
gtggaggcgttttttgccgaggcacaggcgcgcggccagcgggtggtcgcgggcaagacc
tgtatggaccgcaatgcgccagatttcctgcgcgacacggcacagagcgcctatgaccag
tccaaggctctgttgcagaagtggcatggggtggaccggatctcctatgcgatcacgcct
cggttttcgcccacctcgacgtcggaacagctggatgcgatgggtgcgctctgggccgag
catcccgattgcctgatgcagacccatctgagcgaacagaccgacgagatcgaatgggtc
aagggcctctatcccgaagcgcgcgattatctggacacgtacgagcagcatgggctcctc
ggcgggtgcggactgtatggccatgccatccacctggagaagcgcgagcgtgaccggctg
cgcgaacatggcgccgggctgatccattgcccgacctcgaacacgttcatcggctcgggc
ctgttcgacatggccgggctgatggcggagggacagcggatcgggctggccaccgatacc
ggtggcgggtccagcttttcgatgctgcgcacgatggccgccgcctatgagatcggccag
ctgcggggcgtgccgctgcacgcggcgcagctgttgtggctggccacccagggctcggcc
cgggcgctgcggatggatcaccagatcggcaacatcgccccggggatggaggcggatctg
gtggtactcgacctcgcctccactcccgccatcgcccagcgcagcgctatggcagacgac
ctgtgggaggcgctgtttccgaccatcatgatgggcgacgaccgcgccatcgccgaagtc
tggatcgccggcaggcgggtctga

DBGET integrated database retrieval system