KEGG   Ruegeria pomeroyi: SPO2956Help
Entry
SPO2956           CDS       T00215                                 

Definition
guanine deaminase
Orthology
K01487  
guanine deaminase [EC:3.5.4.3]
Organism
sil  Ruegeria pomeroyi
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPO2956
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.3  guanine deaminase
     SPO2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3155229..3156512
Genome map
AA seq 427 aa AA seqDB search
MTGQTILRGRVLSFVQSPFDTAPETAVRENEALLIEGGHVTAVGSWDALRREAPQAEVSD
HGERVILAGFVDAHVHYPQTAMIASWGKRLIDWLNTYTFPEERKFADLTYASEIAARYLD
LTAAHGTTTMCSFCTIHPESVEAFFAEAQARGQRVVAGKTCMDRNAPDFLRDTAQSAYDQ
SKALLQKWHGVDRISYAITPRFSPTSTSEQLDAMGALWAEHPDCLMQTHLSEQTDEIEWV
KGLYPEARDYLDTYEQHGLLGGCGLYGHAIHLEKRERDRLREHGAGLIHCPTSNTFIGSG
LFDMAGLMAEGQRIGLATDTGGGSSFSMLRTMAAAYEIGQLRGVPLHAAQLLWLATQGSA
RALRMDHQIGNIAPGMEADLVVLDLASTPAIAQRSAMADDLWEALFPTIMMGDDRAIAEV
WIAGRRV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacagaccattttgcgggggcgggtgctgtcctttgtgcagtccccctttgat
accgcgcccgaaacggccgtccgcgaaaacgaggcgctgctgatcgagggcgggcatgtg
acggcggtcggcagctgggacgcgctgcggcgcgaagccccgcaggcagaggtaagtgat
cacggcgaacgggtaattctggccggcttcgtggatgcgcatgtgcattatccccagacc
gcgatgatcgcgagctggggcaagcggctgatcgactggctcaacacctatacctttccc
gaagagcgcaagttcgccgacctgacctatgcctccgagatcgcggcccggtatctggac
ctgacggcggcgcatggcaccaccaccatgtgcagcttctgcaccatccatcccgagagc
gtggaggcgttttttgccgaggcacaggcgcgcggccagcgggtggtcgcgggcaagacc
tgtatggaccgcaatgcgccagatttcctgcgcgacacggcacagagcgcctatgaccag
tccaaggctctgttgcagaagtggcatggggtggaccggatctcctatgcgatcacgcct
cggttttcgcccacctcgacgtcggaacagctggatgcgatgggtgcgctctgggccgag
catcccgattgcctgatgcagacccatctgagcgaacagaccgacgagatcgaatgggtc
aagggcctctatcccgaagcgcgcgattatctggacacgtacgagcagcatgggctcctc
ggcgggtgcggactgtatggccatgccatccacctggagaagcgcgagcgtgaccggctg
cgcgaacatggcgccgggctgatccattgcccgacctcgaacacgttcatcggctcgggc
ctgttcgacatggccgggctgatggcggagggacagcggatcgggctggccaccgatacc
ggtggcgggtccagcttttcgatgctgcgcacgatggccgccgcctatgagatcggccag
ctgcggggcgtgccgctgcacgcggcgcagctgttgtggctggccacccagggctcggcc
cgggcgctgcggatggatcaccagatcggcaacatcgccccggggatggaggcggatctg
gtggtactcgacctcgcctccactcccgccatcgcccagcgcagcgctatggcagacgac
ctgtgggaggcgctgtttccgaccatcatgatgggcgacgaccgcgccatcgccgaagtc
tggatcgccggcaggcgggtctga

DBGET integrated database retrieval system