KEGG   Ruegeria pomeroyi: SPO3071Help
Entry
SPO3071           CDS       T00215                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sil  Ruegeria pomeroyi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPO3071 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPO3071 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPO3071 (thrC)
Enzymes [BR:sil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPO3071 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3279594..3280985)
Genome map
AA seq 463 aa AA seqDB search
MKYISTRGQAPELTFEEAMLTGLARDGGLYLPAEIPVMGQDEIAALAGLPYEEIAFRVMW
PYVSGSFGEDEFRGIIARAYQGFGHAARAPLKQLNENHFLLELFHGPTLAFKDFAMQLIG
QLFQAALARRGETVTIVGATSGDTGSAAIEAFRGLDAVNVFILFPHGRVSEVQRRQMTTP
ADSNVHALAVDGDFDDCQARVKDMFNDFAFRDGVRLAGVNSINFARVLAQVVYYFSAATS
LGAPHRKVSFTVPTGNFGDIFAGYIAKRMGLPIEQLVVATNQNDILHRCLSGEGYFKGET
IPSISPSMDIQVSSNFERALYYAYGQDGAAVSQLMDELQQGGFHVSQGAMQALRDSFTSG
RASEEETLATIKATLAASGELLCPHSAVGVKVAEEARRADEAPMITLATAHPAKFPAAVE
QASGVFPPLPPRMSDLYERPERVTRIANDLAALQDHIRRHIPA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctcgacccgcgggcaggcgcccgagcttaccttcgaagaggcgatgctg
accggtctggcccgcgacggtggcctttacctgcccgccgagatcccggtgatgggccag
gacgagatcgccgcgctggcgggcctgccctatgaagagatcgcctttcgcgtgatgtgg
ccctatgtaagcggctcctttggcgaggacgagttcaggggcatcatcgcccgcgcttac
caaggctttggccatgccgcccgggcgccgctgaaacagctcaacgagaaccacttcctg
ctggagctgttccacgggccgacgctggccttcaaggatttcgcgatgcagctgatcggc
cagctgtttcaggcggcgcttgcgcggcgcggcgagacggtgaccatcgtcggcgccacc
tcgggcgataccggctcggccgcgatcgaggcgttccgcgggctggatgcggtcaatgtc
ttcatcctgttcccgcatggccgggtcagcgaagtgcagcgacgccagatgaccacgccc
gccgacagcaacgtgcacgcgctggcggtggatggcgatttcgacgactgccaggcgcgg
gtcaaggacatgttcaacgacttcgccttccgtgacggggtgcggctggctggcgtcaac
tcgatcaattttgcgcgcgtgctggcgcaggtggtctattatttctcggcggccaccagc
ctgggcgcgccgcatcgcaaggtcagcttcaccgtgcccacgggcaatttcggcgacatc
tttgcgggctatatcgccaagcgtatggggctgccgatcgagcagctggtggtggccacc
aaccagaacgacatcctgcaccgctgcctgtcgggcgagggctatttcaaaggggaaacc
atcccctcgatcagcccgtcgatggatatccaggtcagctccaacttcgaacgcgcgctt
tattacgcctatggccaggacggcgcggcggtgtcgcagctgatggacgagctgcaacag
ggcgggttccatgtcagccagggggcgatgcaggccctgcgcgacagtttcacctcgggc
cgcgcctcggaagaggagacgctggccaccatcaaggcgacgctggccgccagcggcgag
ctgttgtgcccgcattcggcggtgggggtgaaggtcgccgaagaggcccgcagggccgat
gaggcgccgatgatcaccctggccaccgcgcatccggcgaaattccccgccgcggtggaa
caggccagcggcgtgtttccgccccttcccccgcgcatgtcggatctatatgaacgtccg
gaacgggtgacccggatcgccaacgatctggccgccctccaggatcatatcagaaggcat
atccctgcgtga

DBGET integrated database retrieval system