KEGG   Ruegeria pomeroyi: SPO3116Help
Entry
SPO3116           CDS       T00215                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sil  Ruegeria pomeroyi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sil00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPO3116 (ruvA)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPO3116 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(3326499..3327173)
Genome map
AA seq 224 aa AA seqDB search
MIGKLTGRLDYRSTDHVLIDVRGVGYIVYCSDRTLAALPGVGEVVALYTDMVVREDLMQL
FGFMSLAEKEWHRLLCSVQGVGAKVSLAILGALGPDGVSRAIALGDWASVKSAKGVGPKT
AQRIVLDLKDKAPGVMAMGGTVAQAMEGAVEVVEVIEPAAPAPRKAAPPGGAGAATAGAL
SALSNLGYGPSDAAAAVAQAAAEAPEAGETDLIRAALRLLAPKT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagttgacggggcggctcgactatcggtccaccgaccatgtgctgatcgat
gtgcgcggggtcggctatatcgtctattgctcggaccggacgctggcggcactgcccggc
gtgggcgaggtggtggcgctttataccgatatggtggtgcgcgaggacctgatgcagctt
tttggcttcatgtcgctggccgagaaggaatggcaccggctgctgtgctcggtccagggg
gtcggggccaaagtgtcgctggccattctgggcgcgctggggccggacggggtgagccgg
gcgattgcgctgggcgactgggcctcggtcaagtcggccaaaggcgtggggccgaagacg
gcgcagcgcatcgtgctcgacctcaaggacaaggcgccgggcgtgatggcgatgggcggc
accgtggcccaggcgatggagggcgcggtagaggtggtcgaggtgatcgaacccgccgct
ccggcaccgcgcaaggccgcgccgcccggcggcgccggtgctgcgaccgctggcgcgctg
tcggcgctgtcaaatctgggctatggcccctcggacgcggccgccgctgtggctcaggcc
gccgccgaagcgcccgaggccggagagacagacctgatccgcgcggcgctgcgcctgctg
gcgcccaagacatga

DBGET integrated database retrieval system