KEGG   Ruegeria pomeroyi: SPO3520Help
Entry
SPO3520           CDS       T00215                                 

Definition
copper-translocating P-type ATPase (EC:3.6.3.4)
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
sil  Ruegeria pomeroyi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3727668..3729845)
Genome map
AA seq 725 aa AA seqDB search
MTAQLRPSPAACPACVAVPAQPARPVPEDVQIALSLPGIHCSACISTVERALQAHPGVED
ARVNLTLKRALIKAAPELRAADLIPVLERAGYEAHELDPGTLNATRTDRAGRDLLMRLAV
AGFASMNVMLLSVSVWSGASDATRDMFHWISAAIAMPAIAFSGQPFFVRAWGALKARRLN
MDVPIVLAIVLALVTSLWETSLSGEHAYFDAALTLTFFLLAGRYLDYRTRAVARSAAEEL
AALEVPRAIRLQDGVETEVAVAQLAVGDLILVRPGGRMPVDGEIVEGRSELDRSLLTGET
LPVFAEPGLVVSAGEVNLTGPLVIRANAVGQDTSLHRMADLVAIAESGRSRYTSLADSAA
KLYAPGVHILSALSFVGWYLYSWDVRTALNIAAAVLIITCPCALGLAVPAVTTAASGRLF
KRGMLIKHATALERLAEVDTVVFDKTGTLTAGTPELTNLGDHRRADMEIALALAEASSHP
LSVAITRAARAAGLHPARIDDVTEVPGFGTEGAWQGQRVRLGRAAWVGAEQAAQTSAWLA
VGDRAPVAFLFSDALRPGAEETVAGLKAAGKEVLLISGDTTGAVESLARRLGIESWMAEA
LPQDKADRVQALADAGKRVLMVGDGLNDTAALAAAHVSISPASALDAARVASDIVLLGND
LSPIAGACDTAIRATKRIRENFRIATVYNVIAVPLAVAGLCSPLIAALAMSTSSITVSLN
ALRLR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcagctccgcccctcgcccgcggcctgtccggcctgtgttgcggttccggcc
cagccggcccgcccggtgcccgaggatgtgcagatcgcgctgtctttgccgggcatccac
tgttcggcctgtatctcgacggtcgagcgcgccttgcaggcccatccgggggtcgaggat
gcgcgggtgaacctgacgctgaaacgggcgctgatcaaggccgcgcccgagttgcgcgcc
gccgatctgatcccggtgctcgagcgcgccggatacgaggcgcacgagcttgatcccggt
acgctcaacgcgacccgcaccgaccgtgccgggcgcgacctgctgatgcggctggcggtg
gcgggctttgcctcgatgaacgtgatgctgctgtcggtctcggtctggtcgggcgcctcg
gacgcgacgcgggacatgttccactggatttccgccgccatcgcgatgcccgccatcgcc
ttttccggccaacccttctttgtcagagcctggggcgcgctcaaggccaggcggctcaac
atggatgtgcccatcgtgctggccatcgtgctggcgctggtcacctcgctgtgggaaacc
tcgctgagcggcgaacacgcgtatttcgatgcggcgctgacgctgacctttttcctgttg
gcgggccgctatctggattaccgcacccgcgccgttgcccggtccgcggccgaggaactg
gccgcgctcgaggtgccgcgcgcgatccgtctgcaagacggggtcgagaccgaggtcgcc
gtagcgcaactggcggtgggtgacctgatcctggtgcgccccggcgggcggatgcccgtc
gatggcgagattgtcgagggacgttcggaactggaccgctcgctgcttaccggagagacg
ttgccggtctttgccgaaccggggcttgtggtcagcgcgggcgaggtcaacctgaccgga
ccgctggtgatccgtgccaatgcggtggggcaggatacctcgctgcaccgcatggccgat
ctggtggccatcgccgaaagcgggcgctcgcgctatacctcgctggccgacagcgccgcg
aaactctatgcgccgggggtgcatatcctgtcggcgctcagctttgtcggctggtatctc
tacagttgggatgtgcgcactgcgctcaacatcgccgcagccgtactgatcattacctgc
ccctgtgcgctgggccttgcggtgccggcggtgaccacggccgcctcggggcggctgttc
aagcggggaatgctgatcaagcacgccaccgcgctggaacggctggccgaagtggacaca
gtcgtgttcgacaagaccggcacgctgacggcgggcacgcccgaattgaccaacctgggc
gatcaccgccgggccgacatggagatcgcgctggccctggccgaggcgtcctcgcatccg
ctttccgttgcgatcacccgcgcggcgcgggccgccgggctgcatccagcccggatcgac
gatgtgaccgaggttccggggttcggcaccgaaggtgcctggcagggtcagcgggtgcgg
ctgggccgggccgcctgggtcggggccgagcaggccgcgcagacctcggcctggctggcg
gtcggcgaccgggcgccggtggcgtttctgttctccgacgcgctgcgcccgggggccgag
gagaccgtcgcgggcctcaaggccgcgggcaaggaggttctgctgatctcgggcgatacc
accggcgcggtcgagtcgctggcccgccgtctggggatcgagagctggatggccgaggcc
ttgccgcaggacaaggccgaccgggtgcaggccttggccgatgcgggcaagcgggtgctg
atggtgggcgatgggctgaacgacactgccgcactggccgccgcccatgtgtcgatctcg
cccgcctcggcgctggacgcggcgcgcgtggcctctgatatcgtgctgttgggcaacgac
ttgtccccgattgccggggcctgcgataccgccatccgcgccaccaaacgtatccgcgag
aatttccgcatcgccactgtctataacgtgatcgcggtgccgcttgcggtggctggcctc
tgttcgccactgatcgcggccttggcgatgtcgacctcgtcgattaccgtgtccctgaat
gccctgcgcctgaggtga

DBGET integrated database retrieval system