KEGG   Ruegeria pomeroyi: SPO3742Help
Entry
SPO3742           CDS       T00215                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sil  Ruegeria pomeroyi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPO3742
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPO3742
Enzymes [BR:sil01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPO3742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3953594..3954115
Genome map
AA seq 173 aa AA seqDB search
MVRIIFLIVLLLVGRSVQAGAVSGSFPSIDGGTLSLEEWRGQPVLVVNTASQCGFTGQYA
GLQALWERYQSAGLVVLAVPSDDFNQELATAAEVKEFCALNYALTLPMTNILHVKGADAH
PFYKAVKAETGFEPAWNFNKVLVAPDGSIAATFGSAVKPDSARMQREIEALLN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcatcatttttctgatcgttcttctgcttgtcggccggtcggttcaggcaggt
gccgtttccggcagttttccctcgatagatgggggcacgctgtctctggaagagtggcgg
gggcagccggtcctggtggtcaacaccgcttcgcaatgcgggttcaccggccagtatgcc
gggctgcaagctctgtgggagagatatcagagcgccggtttggtcgtgcttgccgtgccg
tcggatgacttcaaccaggaactggcgaccgcggccgaggtcaaggagttctgcgcgctg
aattacgctctgacgttgccgatgaccaatatcctgcatgtgaagggggcagacgcgcat
ccgttctacaaggcggtcaaggccgagaccgggttcgagccggcctggaacttcaacaag
gttctggtggcaccggacgggtctattgcggcaaccttcgggtcggctgtcaaaccggat
tcggcgcggatgcagcgcgagatcgaggcattgctgaactag

DBGET integrated database retrieval system