KEGG   Ruegeria pomeroyi: SPO3790Help
Entry
SPO3790           CDS       T00215                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00010  Glycolysis / Gluconeogenesis
sil00020  Citrate cycle (TCA cycle)
sil00620  Pyruvate metabolism
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
sil01200  Carbon metabolism
Module
sil_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO3790 (acoC)
   00020 Citrate cycle (TCA cycle)
    SPO3790 (acoC)
   00620 Pyruvate metabolism
    SPO3790 (acoC)
Enzymes [BR:sil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPO3790 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl DUF915 PGAP1 Abhydrolase_5 Thioesterase Ndr Esterase Biotin_lipoyl_2 DUF676
Motif
Other DBs
NCBI-ProteinID: AAV97010
UniProt: Q5LLX5
Position
complement(4003563..4004663)
Genome map
AA seq 366 aa AA seqDB search
MSDLITPILMPKWGLSMREGTLAAWHVEEGTEISPGDEIMDVETDKIANVVEAADGGLLR
RRVGQAGEVYPVRALLGVLAPESVSDAEVDAYVDAFEMPQIEEEEDTGPAHEFADLGVGR
IRYITREGEGVPVILIHGFGGDLDNWLFNIDALAEKAPVHALDLPGHGQSVKTVDDPGLG
TMVDAVVQLMDHLNIDKAHLVGHSMGGLVSGQVAIEHPGRVASLSLICSAGLGDEINAGY
IDGFVGAASRRDLKPVLKDLFADQSLVSRAMVDDLLKYKRLDGVQSFLEALRGNLFAGGR
QAAGIAAALAGFNGPIQVIWGADDAVIPQSHANAIADASVTVVEGAGHMVQMENASRVNE
LISHHL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctgattacgccgatcctcatgccgaaatggggcctttccatgcgggaaggc
acccttgcggcctggcatgtcgaggaaggcaccgagatcagtcccggcgacgagatcatg
gatgtcgaaaccgacaagatcgcgaatgtcgtggaggccgccgatggcggtctcctgcgg
cggcgtgtcggccaggcaggcgaagtctatccggttcgcgcgcttttgggtgtcctggcc
cccgaaagcgtcagcgatgccgaggtcgacgcctatgtcgatgccttcgagatgccgcaa
atcgaagaagaggaagataccggcccggcccatgaattcgccgatctgggcgttgggcgt
atccgctatatcacgcgcgaaggcgaaggcgtgccggtcatcctgatccacggctttggc
ggtgatctggacaactggctgttcaatatcgacgcgctggccgaaaaggcgccggttcac
gcgctggacctgcccggccatggccagtcggtcaagacggtggatgatccgggccttggc
acgatggtcgatgcggtggtgcaactgatggatcatctgaacatcgacaaagcgcatctg
gtcggccattcgatgggcgggctcgtctcggggcaggtggcgatcgagcatcccggccgg
gttgcctcgctgtcgctgatctgttctgccggtctgggagatgagatcaacgccggctat
atcgacggctttgtcggggcggccagccgccgcgatctcaagcccgtgctgaaggacctg
tttgcagatcagagcctggtcagccgcgcgatggtcgatgacttgctgaaatacaagcgg
ctggatggggttcaaagcttcctcgaggcgctcaggggcaaccttttcgcaggcggccgg
caagccgccgggatcgctgcggcgctggccggtttcaacgggccgatccaggtgatctgg
ggcgccgatgacgcggtgatcccgcaatcccatgccaatgccatcgccgatgccagcgtc
accgttgtcgagggcgcgggccacatggtccagatggaaaacgcctcccgggtcaatgag
ctgatctcccatcatctctga

DBGET integrated database retrieval system