KEGG   Ruegeria pomeroyi: SPOA0050Help
Entry
SPOA0050          CDS       T00215                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
sil  Ruegeria pomeroyi
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SPOA0050 (nosZ)
Enzymes [BR:sil01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     SPOA0050 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase_p: 
UniProt: 
Position
megaplasmid:45091..46998
Genome map
AA seq 635 aa AA seqDB search
MSDHDNNLSVTRRGLLGATATGAVLASTGLGATLMTAREASAAAKVNLEPGELDEYYGFW
SSGQTGELRILGIPSMRELMRVPVFNRCSATGWGQTNESLKVLTEGLLPETKQFLASNGK
KTYDNGDLHHPHMSFTDGTYDGRYLFMNDKANTRVARVRCDVMKCDKIIEIPNAHDIHGL
RPQKYPRTGYVFANGEHEAPLVNDGQILDDPSQYVNIFTAIDGDSMEIAWQVIVSGNLDN
TDCDYQGKYAFSTSYNSEMGMNLAEMTENELDHVVVFNLKEIEAGIAAGDYQELNGVKVV
DGRKGAGNNYTRYIPIPNSPHGVNAAPDKRHIMINGKLSPTVSVIDVEKVDALFADNADP
RSAIVAEPQLGLGPLHTAFDNKGNAYTTLFLDSQVVKWNIAKAIEAYAGADVDPILDKVD
VQYQPGHNSTSMGETAEADGKWLISMNKFSKDRFLNVGPLKPENEQLIDISGDKMKVVHD
GPTFAEPHDSIIVHRSKVNPVNVWDRNDPMWEDARQQAAADGVDLEEGAEEPIRDGNKVR
VYMTSVAPTFSLEKFTVKQGDEVTIYVTNLDDVDDVTHGLCMANFGIAMEVAPQATASVT
FIADRPGVHWFYCQWFCHALHMEMRGRMFVEPRGA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccacgataacaacctgagcgtcacccgccgcggcctgctgggcgcgacagcc
accggcgccgttctcgccagcaccgggctgggtgccaccctgatgaccgcgcgcgaggca
tccgccgccgccaaggtcaatctcgaacccggcgagctggacgagtattacggcttctgg
tcctcgggtcagaccggcgagctgcgtatcctcggcatcccctcgatgcgcgagctgatg
cgggtgccggtgttcaaccgctgctcggcgaccggctggggccagaccaacgagtcgctc
aaggtgctgaccgagggcctcttgcccgagaccaagcagttcctggcgtccaacggcaag
aaaacctatgacaacggcgacctgcaccacccgcatatgtcgttcaccgatggcacctat
gacggccgttacctgttcatgaacgacaaggccaacacccgggtggcccgcgtgcgctgc
gacgtgatgaaatgcgacaagatcatcgagatccccaatgcgcatgacatccacggcctg
cggccgcagaaatacccgcgcaccggctatgtctttgccaatggcgagcacgaggcgccg
ctggtcaatgacggccagatcctcgatgatccctcgcaatatgtgaacatcttcaccgcg
attgacggcgacagcatggagatcgcctggcaggtgatcgtgtcgggcaacctcgacaac
accgattgcgactatcagggcaaatacgccttttcgacctcgtacaactcggaaatgggc
atgaacctggccgagatgaccgagaacgagctggaccatgtggttgtcttcaacctcaag
gaaatcgaggctggcatcgcggcgggcgattatcaggagctgaacggcgtcaaggtcgtc
gacgggcgcaagggcgcgggcaacaactatacccgctatatcccgatccccaacagcccg
cacggcgtgaacgccgcccccgacaagcgccacatcatgatcaacggcaagctgtcgccc
accgtctcggtgatcgacgtcgagaaggtcgatgcgctgtttgccgacaatgccgatccg
cgctcggccatcgtggccgaaccgcagctgggccttgggccgcttcacaccgcattcgac
aacaagggcaacgcttataccaccctgttcctggacagccaggtggtgaagtggaacatc
gcaaaggcgatcgaggcctatgccggcgccgatgttgacccgatcctcgacaaggtcgat
gtgcagtatcagccgggccacaactcgacctcgatgggtgaaaccgccgaggccgatggc
aaatggctgatctcgatgaacaagttctcgaaggaccggttcctgaacgtcggccccctg
aagcccgagaacgagcagctgatcgacatttccggcgacaagatgaaggtggtgcatgac
ggcccgacctttgccgagccgcatgacagcatcatcgtgcaccggtccaaggtgaacccg
gtcaacgtctgggaccgcaacgacccgatgtgggaagacgcccgccagcaggccgccgcc
gatggtgtcgacctggaggaaggtgccgaagagccgatccgcgatggcaacaaggtacgg
gtctacatgacgtccgtggcgccgaccttcagcctcgagaagttcacggtgaagcagggc
gacgaggtgacgatctatgtcaccaacctcgacgatgtggatgatgtgacccacgggctg
tgcatggccaactttggcatcgcgatggaagtggcgccgcaggcgaccgcttcggtcacg
ttcattgccgaccgtccgggcgtgcactggttctattgccagtggttctgccacgcgctg
cacatggaaatgcgtggccgtatgtttgtcgaaccgcggggagcataa

DBGET integrated database retrieval system