KEGG   Ruegeria pomeroyi: SPOA0055Help
Entry
SPOA0055          CDS       T00215                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SPOA0055
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPOA0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:50513..50890
Genome map
AA seq 125 aa AA seqDB search
MFKNRLILTILAAGLALPALADGDADKGKKVFNKCKACHAVGEGAANKVGPQLNGIIGAA
AGQVEGFKYSDALIEAAAGGLVWDDESLAAFLAKPKDFMKGTKMSFAGLKKEDEIENVIA
YLQGF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaccgactgatcctgaccattctggccgcagggctggcgctgcccgccctg
gccgatggcgatgccgacaagggcaagaaagtgttcaacaagtgcaaggcctgccatgcg
gtcggcgagggcgcggccaacaaggtcgggccacagctgaacggcatcatcggtgccgcc
gccggtcaggtcgaagggttcaagtattccgacgccctgatcgaggccgccgcagggggt
ctggtctgggacgacgagagcctggccgcgtttctggccaagcccaaggatttcatgaag
ggcaccaagatgtcctttgccgggctcaagaaggaagacgagatcgaaaacgtcatcgcc
tatttgcaaggattctga

DBGET integrated database retrieval system