KEGG   Ruegeria pomeroyi: SPOA0158Help
Entry
SPOA0158          CDS       T00215                                 

Gene name
cuyA
Definition
L-cysteate sulfo-lyase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
sil  Ruegeria pomeroyi
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sil00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase_p: 
UniProt: 
Position
megaplasmid:complement(173964..174983)
Genome map
AA seq 339 aa AA seqDB search
MHLARYPRRFIAHLPTPLERLDRLTAELGGPEIWIKRDDCTGLSTGGNKTRKLEFLMAEA
ELQGADMVMTQGATQSNHARQTAAFAAKLGMDCHILLEDRTGSNNANYNNNGNVLLDHLH
GATTEKRPGSGLDMNAEMEKVAEKFRADGRKVYTIPGGGSNPTGALGYVNCAFEMLNQFN
ERGLKVDHIVHATGSAGTQAGLITGLQAMNAQIPLLGIGVRAPKPKQEENVYNLACATAE
KLGCPGVVAREDVVANTDYVGEGYGIPTESGLEAIRMFAELEAILLDPVYSAKGAAGFID
LIRKGHFKKGERVVFLHTGGAVALFGYDNAFDYSGRWVA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgcccgctatccccgccgcttcatcgcccatctgccgacgccgctggaacgg
ctggaccggctgaccgccgaactgggcgggcccgagatctggatcaagcgcgacgactgc
accggcctgtccaccggcggcaacaagacccgcaagctggaattcctgatggccgaggcc
gagctgcaaggcgctgacatggtgatgacgcagggcgcgacccagtccaaccatgcccgc
cagaccgccgcattcgccgccaagctgggcatggattgccatatcctgctcgaggaccgg
accggctcgaacaacgccaactacaacaacaacggcaacgttctgctcgaccatctgcat
ggcgccaccactgaaaagcgccccggcagcggtctggacatgaatgccgagatggaaaag
gtggccgagaagttccgcgccgacgggcgcaaggtctataccatccccggcggcggctcg
aacccgaccggcgcgctgggatatgtcaactgcgctttcgagatgctgaaccagttcaat
gagcgcgggctgaaggtggaccatatcgtgcatgccaccggcagcgcgggcacccaggca
gggctgatcaccgggcttcaggcgatgaacgctcagatcccgctcttgggcatcggcgtg
cgtgcgcccaagcccaagcaggaagagaatgtctataacctggcctgcgccaccgccgag
aagctgggttgccccggtgtcgtcgcgcgcgaggacgtggtggccaataccgactatgtc
ggcgaaggctatggcatcccgaccgaaagcgggctggaggcgatccgcatgttcgccgag
cttgaggcgatcctgcttgacccggtctattcggccaagggcgcggctggcttcatcgac
ctgatccgcaagggtcatttcaaaaagggcgagcgggtggtgttcctgcataccggcggc
gctgtggcgctgttcggctatgacaacgcctttgactattcgggacgctgggtggcctaa

DBGET integrated database retrieval system