KEGG   Ruegeria pomeroyi: SPOA0158Help
Entry
SPOA0158          CDS       T00215                                 

Gene name
cuyA
Definition
L-cysteate sulfo-lyase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
sil  Ruegeria pomeroyi
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPOA0158 (cuyA)
Enzymes [BR:sil01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     SPOA0158 (cuyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase_p: 
UniProt: 
Position
megaplasmid:complement(173964..174983)
Genome map
AA seq 339 aa AA seqDB search
MHLARYPRRFIAHLPTPLERLDRLTAELGGPEIWIKRDDCTGLSTGGNKTRKLEFLMAEA
ELQGADMVMTQGATQSNHARQTAAFAAKLGMDCHILLEDRTGSNNANYNNNGNVLLDHLH
GATTEKRPGSGLDMNAEMEKVAEKFRADGRKVYTIPGGGSNPTGALGYVNCAFEMLNQFN
ERGLKVDHIVHATGSAGTQAGLITGLQAMNAQIPLLGIGVRAPKPKQEENVYNLACATAE
KLGCPGVVAREDVVANTDYVGEGYGIPTESGLEAIRMFAELEAILLDPVYSAKGAAGFID
LIRKGHFKKGERVVFLHTGGAVALFGYDNAFDYSGRWVA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgcccgctatccccgccgcttcatcgcccatctgccgacgccgctggaacgg
ctggaccggctgaccgccgaactgggcgggcccgagatctggatcaagcgcgacgactgc
accggcctgtccaccggcggcaacaagacccgcaagctggaattcctgatggccgaggcc
gagctgcaaggcgctgacatggtgatgacgcagggcgcgacccagtccaaccatgcccgc
cagaccgccgcattcgccgccaagctgggcatggattgccatatcctgctcgaggaccgg
accggctcgaacaacgccaactacaacaacaacggcaacgttctgctcgaccatctgcat
ggcgccaccactgaaaagcgccccggcagcggtctggacatgaatgccgagatggaaaag
gtggccgagaagttccgcgccgacgggcgcaaggtctataccatccccggcggcggctcg
aacccgaccggcgcgctgggatatgtcaactgcgctttcgagatgctgaaccagttcaat
gagcgcgggctgaaggtggaccatatcgtgcatgccaccggcagcgcgggcacccaggca
gggctgatcaccgggcttcaggcgatgaacgctcagatcccgctcttgggcatcggcgtg
cgtgcgcccaagcccaagcaggaagagaatgtctataacctggcctgcgccaccgccgag
aagctgggttgccccggtgtcgtcgcgcgcgaggacgtggtggccaataccgactatgtc
ggcgaaggctatggcatcccgaccgaaagcgggctggaggcgatccgcatgttcgccgag
cttgaggcgatcctgcttgacccggtctattcggccaagggcgcggctggcttcatcgac
ctgatccgcaagggtcatttcaaaaagggcgagcgggtggtgttcctgcataccggcggc
gctgtggcgctgttcggctatgacaacgcctttgactattcgggacgctgggtggcctaa

DBGET integrated database retrieval system