KEGG   Ruegeria pomeroyi: SPOA0180Help
Entry
SPOA0180          CDS       T00215                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
sil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sil00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPOA0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AAV97314
UniProt: Q5LL49
Position
megaplasmid:complement(194488..194853)
Genome map
AA seq 121 aa AA seqDB search
MKTFMLSGLVIAGLACSAQADGDPEEGKKVFKKCAACHAIEEGKNKVGPSMFGVWERPAG
AVEGFKYSQPMAEAGYTWDEEHLAGFLAAPKKYLPGTKMTFPGVKKEEQLADLLAYLKTL
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcatgctgagcggcctcgtgatcgctggtctggcctgcagcgcgcaggct
gacggcgatcctgaggaaggaaagaaggtattcaagaaatgtgctgcctgccatgcgatc
gaggagggtaagaacaaggtcggaccctcgatgtttggtgtctgggagcggcctgccggt
gcggttgagggtttcaagtattcccaacccatggccgaggccggatatacttgggacgag
gaacatctggcaggcttccttgccgcccccaagaagtatctgcccggaacaaagatgacc
tttccaggggtcaagaaagaagagcagcttgctgatcttctggcctatctcaaaacgctt
cagtga

DBGET integrated database retrieval system