KEGG   Ruegeria pomeroyi: SPOA0180Help
Entry
SPOA0180          CDS       T00215                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sil00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sil02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(194488..194853)
Genome map
AA seq 121 aa AA seqDB search
MKTFMLSGLVIAGLACSAQADGDPEEGKKVFKKCAACHAIEEGKNKVGPSMFGVWERPAG
AVEGFKYSQPMAEAGYTWDEEHLAGFLAAPKKYLPGTKMTFPGVKKEEQLADLLAYLKTL
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcatgctgagcggcctcgtgatcgctggtctggcctgcagcgcgcaggct
gacggcgatcctgaggaaggaaagaaggtattcaagaaatgtgctgcctgccatgcgatc
gaggagggtaagaacaaggtcggaccctcgatgtttggtgtctgggagcggcctgccggt
gcggttgagggtttcaagtattcccaacccatggccgaggccggatatacttgggacgag
gaacatctggcaggcttccttgccgcccccaagaagtatctgcccggaacaaagatgacc
tttccaggggtcaagaaagaagagcagcttgctgatcttctggcctatctcaaaacgctt
cagtga

DBGET integrated database retrieval system