KEGG   Ruegeria pomeroyi: SPOA0235Help
Entry
SPOA0235          CDS       T00215                                 

Gene name
speB-4
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sil  Ruegeria pomeroyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPOA0235 (speB-4)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SPOA0235 (speB-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase_p: 
UniProt: 
Position
megaplasmid:257036..258022
Genome map
AA seq 328 aa AA seqDB search
MSQKDTEFFQPVSGMDLPRFAGVPTFMRLPHVTPDHAAYDQVQIGLVGVPWDAGTTNRPG
PRHGPRQLRDLSTMIRAGNPATGVNPFALVNCADLGDVAPNPIDIMDCMDRISRFYAGLK
SSGILPVTAGGDHLTTLPVLRGLASDAPVGLIQFDSHTDLFDSYFGGNKYTHGTPFRRAI
EEGLVDPRRMVQIGIRGTAYNTEDVEWGEAQGVRIIRIEEFFDRGVADVMAEARDIVGDK
PTYCTFDIDFVDPAYAPGTGTPEVGGPNSFQALQVVRELSGLTLIGADLVEVSPPFDAQG
NTAWLGASILFEMLCVCAKAISARARDA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaaggatacggagttctttcagccggtctcggggatggatctgccgcgcttt
gccggggtgccgacattcatgcgcctgccgcatgtgacgcccgaccatgcggcttacgat
caggtccagattggccttgtcggtgtgccctgggatgcgggcaccacgaaccgccccggc
ccgcgccatggcccgcgccagctgcgcgacctctccaccatgatcagggcgggcaacccg
gcgaccggggtcaatccctttgcactggtcaattgcgccgatctgggcgacgtggccccc
aacccgatcgacatcatggactgcatggaccggatttcccggttttatgccggcctgaaa
tccagcggcatccttcccgtcaccgctggcggcgatcaccttacgaccttgccggtgctg
cgcgggctggccagtgacgcgccggtcggtctgatccagttcgacagtcacaccgatctg
ttcgacagctacttcggcggcaacaaatacactcatggcaccccgttccggcgtgccatc
gaagagggcctggtcgaccccaggcgcatggtgcagatcggcattcgcggcaccgcctac
aataccgaggacgtggaatggggcgaggcgcagggcgtccggatcatcaggatcgaggaa
ttctttgaccggggcgtggccgatgtcatggccgaggcgcgcgacatcgtcggggacaag
ccaacctattgcacctttgacatcgatttcgtcgatccggcctatgcccccggaaccgga
acgcccgaggtcggcgggccgaacagttttcaggccttgcaggtggtgcgcgaattgtca
gggctgacgctgatcggtgcggatctcgttgaggtctcgccgccgtttgacgcgcaggga
aacaccgcctggctgggtgcgtcgatcctgttcgagatgctctgcgtctgtgccaaggcc
atctctgcgcgcgcgcgggatgcctga

DBGET integrated database retrieval system