KEGG   Ruegeria pomeroyi: SPOA0424Help
Entry
SPOA0424          CDS       T00215                                 

Gene name
fabJ-2
Definition
fatty oxidation complex, alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sil  Ruegeria pomeroyi
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPOA0424 (fabJ-2)
   01212 Fatty acid metabolism
    SPOA0424 (fabJ-2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPOA0424 (fabJ-2)
   00650 Butanoate metabolism
    SPOA0424 (fabJ-2)
  Lipid metabolism
   00071 Fatty acid degradation
    SPOA0424 (fabJ-2)
   01040 Biosynthesis of unsaturated fatty acids
    SPOA0424 (fabJ-2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPOA0424 (fabJ-2)
   00310 Lysine degradation
    SPOA0424 (fabJ-2)
   00380 Tryptophan metabolism
    SPOA0424 (fabJ-2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPOA0424 (fabJ-2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPOA0424 (fabJ-2)
   00281 Geraniol degradation
    SPOA0424 (fabJ-2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SPOA0424 (fabJ-2)
Enzymes [BR:sil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SPOA0424 (fabJ-2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SPOA0424 (fabJ-2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SPOA0424 (fabJ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase_p: 
UniProt: 
Position
megaplasmid:complement(469613..471757)
Genome map
AA seq 714 aa AA seqDB search
MGDFHYAKDADGIVTVTMNMDGPVNAMNAEFWPLFAATMDRIEAEPELKGVIWTSAKDTF
FAGGDLKMLKSIEPDGVEALFRSVEATKAVMRRMEKQPVPHVAAINGAALGGGFEICLAC
NHRIAADNPKTKIGLPEVTLGLLPGGGGTVRLTWLLGLEGAMPFLLEGRQVSPDKALKAG
LIHQVVPADQLLTRAKEYILSVQGDAAAVTQPWDTKGYKIPGGPSTAPHNMTRIAGAAAM
LFKKTRGLMPAPTRILDIMTEAAGKVDFDTATRYESRRFVSLTPLASTKNMIETLFFGMN
KVNGGASRPKGVPTSKVQRLGILGAGMMGQGIAFSAATAGLPVVLKDQTLEAAERGKAYT
ATLLDKRVKQGRMSAEEREAVLALITPTDKADDLKGCDLIIEAVFEKIDIKDAVLAEHEA
LLAENGIWGSNTSTLPITRLATGATRPENFVGLHFFSPVDKMPLLEIIAGEKTSDETLAR
AFDFARQIRKTPIIVGDSTGFYTSRTIGTKIIEAVELVAEGHDPLRVDNLSRLTGMPTGM
LSLLDEVQIKLVTDIYNTQVEMGLLDPDKEQNPAARAMLAEMISQHGRHGRATGKGFYDY
DGQGKTIWPGLAAWRKEGADIPDADIKDRILFRAVLESLRCLEEGVLRTVEDGNIGSILG
IGAPVHTGGYLQYVNTYGPARFLARCEELAGKYGDRFAPPEILRTHVAEGRALA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattttcactacgcaaaggatgccgatggcatcgtcaccgtgaccatgaacatg
gacgggccggtcaacgcgatgaatgccgagttctggccgctgtttgccgcgaccatggac
cggatcgaggcggagccggagctgaaaggcgtgatctggacctcggccaaggacacgttc
tttgccgggggcgacctgaagatgctgaaaagcatcgagcccgacggggtcgaggcgctt
ttccgatccgtcgaggcgaccaaggccgtgatgcggcggatggagaagcagcctgtgccc
catgtcgccgcgatcaatggcgccgcacttgggggcgggttcgagatctgtctggcctgc
aaccaccgcatcgccgccgacaatccaaaaaccaagatcggcctgccagaggtcacgctg
ggcctgctgcccggcggtggcggcactgtgcggttgacctggcttctgggtctggaaggc
gcgatgcccttcctgctcgaagggcgacaggtgtccccagacaaggcgctcaaggccggg
ctgatccatcaggtggtgcccgcagatcaactcctgacccgtgccaaggaatacatcctg
tcggtgcagggggatgcggcggcggtgactcagccctgggataccaagggttacaagatc
cccggcgggccatcgaccgcgccccataacatgacccgtatcgcgggcgccgccgcaatg
ctgttcaagaagacacgcgggctgatgcctgcgcccacgcgtatcctcgacatcatgacc
gaggcagcgggcaaggtcgatttcgacaccgccacgcgctatgaaagccgccgtttcgtc
tcactgaccccgctggcgagcaccaagaacatgatcgaaacgctgtttttcggcatgaac
aaggtcaatggcggcgccagccggcccaagggcgtgccgacctccaaggtgcagcgcctg
ggcattctgggcgcgggcatgatgggtcagggcatcgccttttcagcggccacggcaggg
ctgcccgtggtgctcaaggaccagacgctagaggcggccgagcgtggcaaggcctatacc
gccaccctgctcgacaagcgggtcaaacagggccggatgagcgccgaggagcgcgaggcg
gtgctggccttgatcacgccgaccgacaaggccgacgacctgaaaggctgcgacctgatc
atcgaggcggtgttcgaaaagatcgacatcaaggatgcggttctggccgagcatgaggcg
ctgctcgctgaaaacggcatctgggggtccaatacctcgaccctgccgatcacgcggctg
gccacgggcgccacacggcccgagaacttcgtcggtctgcatttcttctcacccgtcgac
aagatgccgctgttggagatcatcgcgggcgagaagacctcggacgagacgctggcgcgc
gccttcgactttgcccgccagatccgcaagaccccgatcatcgtgggtgacagcacgggg
ttctatacctcgcgcaccatcggcaccaagatcatcgaggcggtggaactggtggccgaa
ggccacgacccgctgcgcgtcgacaacctgtcgcgcctcaccggcatgcccaccggcatg
ctgtcgctgcttgacgaggtgcagatcaagctggtgaccgatatctacaacacccaggtg
gaaatgggcctcttggaccctgacaaggaacagaacccggccgcccgcgccatgctggcc
gagatgatcagccagcacggccgccatggccgcgccaccggcaaggggttctatgactat
gacggacagggcaagacgatctggccgggactggccgcctggcgcaaggagggggccgac
attccagacgcggatatcaaggaccgcatcctgttccgcgccgtgctggaaagcctgcgc
tgtctggaggaaggcgtgctgcgcacggtcgaggatggcaatatcggctcgatccttggg
atcggcgcgccggttcataccggcggctatctgcaatatgtgaacacctacggcccggcg
cggttcctggcccggtgcgaggagctggcgggcaaatacggagaccggttcgccccaccc
gagatcctcagaacacatgtcgccgagggccgcgccctggcctga

DBGET integrated database retrieval system