KEGG   Sulfolobus islandicus M.16.27: M1627_0238Help
Entry
M1627_0238        CDS       T00900                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M1627_0238
Enzymes [BR:sim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     M1627_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(205313..206164)
Genome map
AA seq 283 aa AA seqDB search
MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAVAVTKLGHSAKLLAKV
GKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRGDGTLSMVRRLGASILLTREDV
KRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESIDVDILYINEKEYEMIEG
KNIKARFIVIKMGKKGAKIITETEECSVEPIQVEKVVDTTGAGDTFDAAFNVTYSEEKDI
IKSLQVASVASGLKVTKIGGISSPTLEEVREYLRKKKPNVICK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgatacacctagcagtggggagatttaacattgatattatagtaaaattggattctatt
ccacctatagattccagtcatatgacggatgttcttgaaatcatgcccggaggagctgca
acaaactatgcagtggctgtgactaaactgggtcactctgctaaactattagcaaaggtt
gggaaaagcgaagtagttagaagtctaatggaaaaagtagtagaattaggggtaggatta
gaatacgtagaggaattaaacgagaaacctagtgcaacactaatcttcttgagaggtgat
ggaacactatctatggtaagaagacttggcgcatcaatattgctaacaagagaagatgta
aaaaggcgttttggactgtttgacgttattcacttcgcctcagtatcaccaaacgttgtt
gtgagagatccttatgcaaaattagtaagctatgatcctggcccacaagctaaaaatata
gagtcgattgacgtagacatcttatatattaatgaaaaagagtatgaaatgatagaaggt
aagaacataaaggccagatttatcgtcattaagatgggcaagaaaggggcaaagataatt
actgagactgaagagtgttcagttgaaccaatacaagtagaaaaggtagttgatactact
ggagctggagatacctttgatgcagcatttaatgtaacatattctgaggaaaaggatatt
ataaagagtctacaggttgctagcgttgcatctggtcttaaggttacgaagataggagga
atttcttcaccaacattagaagaggtaagagagtatttaaggaagaagaaaccaaatgtt
atatgtaaatga

DBGET integrated database retrieval system