KEGG   Sulfolobus islandicus M.16.27: M1627_0651Help
Entry
M1627_0651        CDS       T00900                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sim00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sim00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sim00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sim00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
610244..610996
Genome map
AA seq 250 aa AA seqDB search
MHAVITAAGLGTRMLPASKEIPKEMFPIPFNNGFKPIIQIIFEQLYNKGIRDFVIVVGRG
KRVIEDHFTPDYDFVSYLEKVGKEKQARELLTFYSKIEKSNIAFVNQPEPKGFGDAVLRV
EPFINDKFIVVAADTLLREIPDLIPNSFLVTEVEDPRPYGVVILEGDRVIDVEEKPKNPK
SRFIIVPYYMFTYDIFHALREVKCNGELQLTEGIKILLKKGVEFIAKRVNDVYDLGSIEN
YIASIKKIIG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcagtaataactgcagctggattaggcactcgaatgttacccgcttctaaagaa
attcctaaggagatgtttccaattccctttaacaatggatttaagccaattatacaaata
atctttgagcaactttataacaagggtataagggatttcgttatagttgttggtaggggt
aagagggtaattgaagatcattttacaccagattacgattttgtctcttaccttgaaaaa
gtaggtaaagaaaagcaggcaagggagttattaacattttactctaaaatagagaaaagc
aatatagcatttgtaaatcagcctgaaccaaaaggatttggagatgcggtactgagagta
gaaccttttattaatgataaattcattgtagtagcagcagacactctattaagagagatt
ccagatttaatacctaactcttttctagttactgaagtagaagatcctagaccatatggt
gtagtaatattagagggagatagagttatagatgtcgaggaaaaacctaagaatcctaaa
tcccgttttataatagttccttactatatgtttacatatgatatatttcacgccttaaga
gaagttaagtgtaacggagaattacaacttactgaagggataaaaatattgctgaaaaaa
ggtgtggaatttattgcaaaaagagtaaatgatgtttatgatctgggtagtatagagaat
tatattgcatccataaagaaaattattggataa

DBGET integrated database retrieval system