KEGG   Sulfolobus islandicus M.16.27: M1627_0664Help
Entry
M1627_0664        CDS       T00900                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00620  Pyruvate metabolism
sim00630  Glyoxylate and dicarboxylate metabolism
sim01100  Metabolic pathways
sim01110  Biosynthesis of secondary metabolites
sim01120  Microbial metabolism in diverse environments
sim01200  Carbon metabolism
Module
sim_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M1627_0664
   00630 Glyoxylate and dicarboxylate metabolism
    M1627_0664
Enzymes [BR:sim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     M1627_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF4413
Motif
Other DBs
NCBI-ProteinID: ACP54627
JGI: KislK20664
UniProt: C3N3B6
Position
complement(627194..629674)
Genome map
AA seq 826 aa AA seqDB search
MSFGLKISEEVYQKYSDLFGEKTINDRIVNVEKLIEELAVEFSDEIRRVINKRRQWLESK
DPVTSKGAFPSFDEVFVDADGNKRTFREIIQGMIDNFLGVQSKLRWRLNENVPIPKDAHP
LNNPGLEITGPWYPLSRAYNQINSDVACVMEDEEDASPAWYIPFGSGKTTADVWEGRKNV
KLFLSGKAPNPYYEKGKTYSLNKPRDKWPVIFHRLPGLHLLDFDITLNGKPVPAIIVSAV
IYTLNNYNSLKSAGSGVYFYLPKTQTPDEALVIEKILRRIESKLGLKIGTLKIALLYEEV
NAGRFFPIILWIFRERLIKSNNGRWDYLGSLIEMWLQEKVLPDPQNITMTSPNMMAYQKY
NALMMLLAGAKNGEADSAPVGGMAAVMLYPQTDPFGRNRYNLKALRGMKLDKLRERLIGL
IFVAEDKVEGKVTLEEVINGKVKGKLYDMFRQSWVATKEEAYVEAGSKPLRVSLEELQKI
IDAPVNYIEVEGTKLPTVDSGLTPEERALFQKLGLINERGKITPWVITKEMINTPEKLLF
NKELWGGKDLWHSLYDIPEGDITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFM
NDLATYRIFTSWLWSVINRDASFTKDGYIKGPKLTKDGVIPAEDVLKVTKGTKIKDIFEK
LWELHLDWTYEFYKEQDMRAARKIAETFGKTNNTSTVEEVYKVVSEAYRSGPFREMSAKE
AAQKLAKILNADASEIEEELINLAPRFDRAMAPVIMEILMKQMLYPKYIMNSGKILFILS
PLDPERRSKVMDSIFSFRKMVEDKVRRGELDKWVLELYDYVYDNYW
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttggccttaaaatctctgaagaggtatatcaaaagtatagtgacctcttcgga
gaaaagaccataaacgataggattgtaaatgtcgaaaaactcattgaagagcttgcagtt
gagttctcggatgagataagaagggttattaataaaaggagacaatggttagaatcaaaa
gatcccgtgacctctaagggtgctttcccatccttcgacgaagtttttgtagacgctgat
ggaaataagagaacctttagggaaatcattcaagggatgatagacaatttcctaggagta
cagtcgaagctgaggtggaggttaaatgaaaatgtacctataccaaaagacgcacacccc
cttaataacccgggattagaaatcactggaccttggtatcctctaagtagggcatataat
caaataaattcagacgtggcatgtgttatggaagatgaggaagatgcctcacctgcatgg
tatattccctttggttctggtaaaacaactgctgacgtatgggagggaagaaagaacgta
aaactctttctctccggtaaggctccaaatccttactacgagaaggggaaaacgtatagc
ctaaacaaacctagagataaatggcctgtgatttttcacagacttcctggattgcacctc
ttggattttgacataacgctaaatggtaaaccagtaccggctataattgtttctgccgtc
atatataccctaaataattacaatagcctaaagagcgcaggctctggggtatatttctat
ctgcctaaaacacagacaccggatgaggcattggtaatagaaaagatcttgagaagaatt
gagtctaaactagggcttaagataggtacacttaagatcgctctcctttacgaagaggtt
aatgcgggaagatttttccctataatactgtggatatttcgtgagaggctcattaaatca
aataacggtagatgggactacttgggaagtttaattgagatgtggttacaagagaaagta
cttcccgatccccaaaacattaccatgacctcaccaaacatgatggcttatcaaaagtat
aacgcacttatgatgctattggctggggcaaagaatggtgaagccgattcagctccagta
ggtggtatggcagcagtaatgctttatcctcaaactgatccgttcgggagaaatagatac
aacttaaaggcattaaggggaatgaagttagataagttaagagagaggctaatagggctt
atttttgtagcagaggataaagttgaaggtaaagttactttagaggaggtaattaatggc
aaagtaaagggtaaactttatgatatgtttagacagagttgggttgcaaccaaggaagag
gcttacgtagaggcggggagtaaacctttaagggtaagcctagaggaattacagaaaata
attgatgcaccagttaactatattgaagtagagggaaccaaattacctactgtggatagt
ggactaacaccagaggaaagagcattattccaaaaacttggtctaattaatgaaagagga
aaaataacaccttgggttataactaaggaaatgattaacactcccgaaaagttactattt
aataaggaattatggggtggaaaagacctatggcattcgttatatgacatcccagaggga
gacattacaccggagcatgttcaacacgcattctatatggcagcaaattatggtttccaa
ttgcttaatggtaacttagctgcagcaatagatgattatgaattaaagcaaagattcatg
aatgatctagctacctatagaatattcacttcttggctatggagtgtgataaatagagac
gctagcttcacaaaggatggatatattaagggaccaaagttaactaaggacggtgtaatt
ccagctgaagatgttctaaaggttacaaaggggactaagataaaggacatattcgagaag
ttatgggagttacacttagattggacatatgagttttacaaagaacaagatatgagagca
gctaggaaaatagcggaaacctttggaaagacaaataatacttccacagtagaagaggta
tataaggtagtttccgaggcttataggtcaggtccgtttagagaaatgtcggctaaagaa
gctgcacagaagttggcaaaaattcttaacgctgacgcctctgagatcgaggaagagctt
attaatttagccccaaggtttgacagagctatggctccagtaataatggaaattttaatg
aaacagatgctatatcctaagtacattatgaatagtgggaagattctcttcatactatcg
ccgttagatccagagaggaggtcaaaggtcatggatagtatattctcgtttagaaaaatg
gttgaagataaggtaagaagaggggaactagataagtgggtattggagttatatgactac
gtttatgataattactggtaa

DBGET integrated database retrieval system