KEGG   Sulfolobus islandicus M.16.27: M1627_0847Help
Entry
M1627_0847        CDS       T00900                                 

Definition
medium-chain-fatty-acid--CoA ligase (AlkK-1)
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M1627_0847
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1627_0847
Enzymes [BR:sim01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     M1627_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(813702..815126)
Genome map
AA seq 474 aa AA seqDB search
MATVLEEYEAIQKELRQEGSIRTDYPPSPSEVLWNKKIMTMPREELEKLKTFRLKRIVKW
TWDHVEFYRKFWKSKGFEPDMIKDWRDVIKIPVLRKDELRKDLQQNPPFGSIFVPELAKR
IRFVGATSGSTGLPTFQGWGALELDYFEEAQARYLWTFAEVKPTKVYANYLNMSGFYSWG
PPLVETAMWRCGATAIAGGGETYFNWKNRHNLIFKLWKVDVFATTPWLHRLIGEEALLEG
WETPFKVLLLHGGAAAENTKKKLFKVHPNAKLAISVWGTTDGHMAIEVPSLDGQLVIWED
MEIFDVVDPKTDESVTEGERGELIATLLNHFTMPLIRYSLGDYVKNEFLTDSDPKYGITH
MRFAEPIPGRVEWMFTVKGKLLLPIYIEDAINEIQDTTGMFNILVYENQMDKLKIRIETR
RSEVDANYDREAREILANKIGISPDDIEIEWVKPGQTVWTGYKLQVFLDQRKKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctacagttttagaagaatatgaggcaattcaaaaagagttaaggcaagagggatca
atcagaacagattacccaccatcaccatcagaagttttatggaataagaaaataatgaca
atgcctagggaggagttagagaaattaaagacttttaggcttaaaaggattgtaaaatgg
acctgggatcatgtggagttctataggaagttttggaaaagtaagggattcgaaccagat
atgattaaggattggagagatgttattaaaataccagtcttaagaaaagatgagctaaga
aaagacttacaacaaaatccgccatttggatcaatttttgttccagaactagctaaaagg
attaggtttgttggagctacttctggatccactggtttgcctacttttcaaggttggggt
gcgttagaattagactattttgaggaggcacaagctagatatttatggactttcgcagag
gttaagccaactaaggtttatgcaaattatctaaatatgagtggattttatagttggggt
ccaccattagttgagaccgcaatgtggagatgtggagctactgcaatagctggtggaggt
gaaacgtattttaactggaaaaatagacataacttaatatttaaactctggaaagttgac
gtatttgctacaacaccttggttacataggttaataggagaagaggctttactagagggt
tgggagactccgtttaaagtgcttctgttacatggtggagcagcagcagaaaataccaaa
aagaagctttttaaagttcatccaaatgctaaactggcaataagtgtttggggtactact
gatgggcatatggctattgaggttccaagtttagatgggcaattagtaatatgggaggat
atggagatatttgacgtagtagatcctaagactgatgaatcagtaacagaaggtgaaaga
ggtgaattaatagcaacattacttaatcattttacaatgcccctaatccgttatagttta
ggagattatgtaaaaaatgaatttctaacagactcagatcctaagtacggtattactcat
atgcgatttgctgagccaataccaggaagggtggaatggatgtttacagtgaaagggaaa
ttacttttaccaatttatatagaagatgctataaacgaaatccaagacactactggcatg
tttaatattttggtttatgagaatcaaatggataagttgaaaattaggattgaaactagg
aggagtgaagtagatgctaattatgatagggaggctagggagatcttagctaataaaatt
ggaataagtccagatgatatagaaatagaatgggttaagcctgggcaaacagtttggaca
gggtataaattacaagtatttttagatcaaagaaagaaaaaataa

DBGET integrated database retrieval system