KEGG   Sulfolobus islandicus M.16.27: M1627_0913Help
Entry
M1627_0913        CDS       T00900                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M1627_0913
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_0913
  Lipid metabolism
   00071 Fatty acid degradation
    M1627_0913
  Amino acid metabolism
   00350 Tyrosine metabolism
    M1627_0913
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M1627_0913
   00626 Naphthalene degradation
    M1627_0913
Enzymes [BR:sim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M1627_0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(886264..887298)
Genome map
AA seq 344 aa AA seqDB search
MKAMKIVEFGKPLELSEVGEITKTKSNQVLIRVQAAGVCHTDVSVRSGVIYKRISANPPR
LPLTPGHEIAGIVEEVGDEVTGFTKGDKVLINPWQGEGNCFYCKIGEDQYCDSPTWLGIT
NDGGFQEYVLSNHNYVYKIRNLSPYEAAPLACAGVTSYRASKLARLNPSSYVAIIGAGGG
LGSIGVQIIRALYGSIIIAIDVNDEGLELASKFGADYTLNSRKEVYQEVLKITNGRGVDA
IIDFVGSENTIKSYYTFLAKLGRYIKVGTFGGGLPNEAGLKIHSMGWQFIGTLTGNRKEF
LEVISLAENGRIKPVVTKLRLEEANEALNNLERNKVTGRQVLIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgaaaattgttgagtttggaaaaccattagaactatcagaggttggcgag
attactaagactaaatcaaatcaagtattaataagagtccaagcagctggagtatgccac
acagacgtttcagtgagaagtggggtaatttacaagaggattagtgcaaatccacctaga
cttccgcttacacccgggcatgaaatagctggaattgtagaggaagttggagatgaagtt
accggattcactaagggtgacaaagttctcataaatccctggcaaggtgagggaaattgc
ttctactgcaaaataggagaagaccagtactgcgactcgcctacgtggttgggtattacg
aatgatgggggttttcaagaatacgtactatccaaccacaattatgtatataagataaga
aatctctcaccttatgaggcagcaccattagcttgtgctggggttacatcatatagggca
agtaaattagctaggttaaatccatccagctacgtagctataattggagccggaggaggg
ttaggaagtattggagtgcaaataatcagagcactttatggttccataattatagctata
gacgtcaacgatgagggactagaactcgcctcaaagttcggagctgactacactttaaac
agtagaaaagaagtatatcaagaagtacttaaaataacgaatggaaggggtgtagatgcc
ataatagatttcgtaggctcagaaaacacgatcaaaagttactatacctttttagctaaa
ttaggaaggtacatcaaagtaggaacctttggcgggggtctacccaatgaggctggatta
aaaatacactcaatgggatggcaattcataggtacactaactggaaacagaaaggaattc
ttggaagtcataagccttgcggaaaacggtaggataaaaccagttgtcactaagttaagg
ttggaggaagcaaatgaggcattgaacaacttggaaagaaataaggtaactggaagacaa
gtattaataccttaa

DBGET integrated database retrieval system