KEGG   Sulfolobus islandicus M.16.27: M1627_0916Help
Entry
M1627_0916        CDS       T00900                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M1627_0916
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_0916
   00620 Pyruvate metabolism
    M1627_0916
   00640 Propanoate metabolism
    M1627_0916
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1627_0916
   00680 Methane metabolism
    M1627_0916
Enzymes [BR:sim01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M1627_0916
Lipid biosynthesis proteins [BR:sim01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M1627_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
889581..891332
Genome map
AA seq 583 aa AA seqDB search
MWERKRYINRRGILLYMRNMVEIIREKKIILRPNLENYEEVRKNFSWSKVREELNYNGDV
NAAELAIHKKGELGDKYGILWVSEEEEKRKYTFRDLERRGATFRRVLEDNGVRSGDRVVI
MSKRVPALYFSFVAIGMLGSVILPIFSTFGEDAIRYRVENSGAKVAIVHESLAEKFRNIH
GIKILKITDDGIEGESNRGVEISYTKRSINDPFLILYTSGTTGKPKGIWHSQDILTFYYV
SGKYHFDMHPQDVFWHTGDPAWVAGFAGVWTAWVNGIPLVSYEGRFKAETWYSNIQEYRV
SVISTAPTALRLLKKEGLELAKKYDLSSVRFVHAGGEYVDPDTVKAGIEIFGVPVHDGYG
QTETATYVIANFISMPIKIGSMGKPLPGVEAVIVDENGNPLPPNTQGILALKPDFPAMAR
GIWGDEERWKRNFKNGYYLTGDTAYVDEDGYFWYLGRSDDVIKVSGYRVSPIEIESVIAT
HPAVAEAGVIALEDPVRGHKIKAYIVLKKNYEPSEELKQQIQNYVRERLAAHMVPREIEF
VSELPHTLSGKIMRRVLKAMESGREIGDISTLENPEIVKKSKE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaagaaaaagatatataaataggagaggtattttattgtatatgaggaacatg
gtagagattataagggagaagaagataattttaagacctaatctggaaaactatgaagaa
gttaggaagaactttagttggagtaaggtaagagaagagttaaattataatggtgatgtc
aacgcagcagaactggcaatacataagaaaggtgaactaggagataaatacggtatccta
tgggttagtgaggaggaagaaaaaaggaaatatacttttagagatttggaaaggagaggt
gctacattcagaagagttttggaggataatggggtaaggagtggcgatagggtagtaatt
atgtctaaaagggtcccagcgctctacttctcctttgtagcaataggaatgttgggtagc
gttatacttcccattttctccacatttggtgaagacgcaataaggtatagggttgaaaat
agcggtgctaaagttgcaatagtgcacgagtcgttagcggaaaagtttaggaacattcat
gggattaagattttgaagattacagatgacggcatagagggagagagcaataggggagtc
gagatttcatacactaagaggtctattaatgatccatttttgatcttatatacctctggg
actacgggaaagcctaaaggtatttggcactctcaagatatattgacgttttactatgta
tcgggtaaatatcatttcgatatgcatccccaagatgtcttctggcatactggagaccct
gcgtgggtagctggatttgctggagtttggaccgcgtgggttaatggtataccgttagtc
tcctatgagggcaggtttaaagctgagacgtggtatagtaatattcaagagtatagggtt
tcagtaatttcaactgccccaactgccttgaggttgttgaagaaggagggattagaatta
gccaaaaagtacgatctctcctcagttagatttgtccacgctggaggagagtatgttgat
cctgataccgtaaaagcgggaattgagatattcggtgttccagttcacgatggatatggg
caaacggaaactgcaacttacgttatcgctaacttcatttcaatgccgataaaaattggt
tccatgggaaagcccctccctggagttgaagctgtgatagtggacgagaacgggaatccg
cttcctccaaatacacaaggtatactagctctaaagccggattttccagcaatggctaga
ggtatatggggagacgaggagaggtggaaacgtaatttcaagaatggatattacttaact
ggagacacagcgtatgttgatgaagatggatacttctggtatttagggagatccgatgac
gtgattaaggtatctggatatagggttagtccaatagagatagagagtgtaattgcgact
catcctgctgtggcggaagctggagttatagctttagaggatccagttagagggcataag
atcaaggcatatatagttctcaagaagaactatgaaccatctgaagagcttaaacaacag
atccaaaactacgttagggagagattagctgctcacatggtacctagggaaatagagttt
gtaagcgaattacctcatacattgagtggaaaaataatgaggagagtattgaaggctatg
gaaagtggtagggagataggtgatattagcactttagaaaacccagaaattgtaaagaaa
tcaaaagaataa

DBGET integrated database retrieval system