KEGG   Sulfolobus islandicus M.16.27: M1627_1002Help
Entry
M1627_1002        CDS       T00900                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00521  Streptomycin biosynthesis
sim00523  Polyketide sugar unit biosynthesis
sim01130  Biosynthesis of antibiotics
Module
sim_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M1627_1002
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M1627_1002
Enzymes [BR:sim01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     M1627_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACP54922
JGI: KislK21002
UniProt: C3N4J7
Position
complement(983722..984252)
Genome map
AA seq 176 aa AA seqDB search
MPFEFENLGMGIVLIKPKVFPDKRGFFLEVFKSEDFTKAEIPNIVQVNMSFSLKGVVRGL
HYQITPKEQGKLVFVPKGKILDVAVDLRKSSPTFGKYVKVELNDENHYILWIPPGFAHGF
QALEDSIVVYFLTHNEYSKSHERCVNYSYVDWPIKEFIISDKDLQCPPLEKAEVFK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgaattcgaaaacttaggaatgggtattgtcctcataaagccgaaagtcttc
ccagataaaagaggcttctttctagaggtatttaaatctgaagacttcactaaagcagaa
attcctaatatcgtacaagttaatatgtcgttctctcttaaaggagtagttagaggattg
cactatcagataactcccaaggaacaaggcaagttagtatttgttcctaaaggtaaaata
ttggacgttgctgtagacctaagaaaatcctcacctactttcgggaaatacgttaaagtt
gagcttaacgatgagaaccactacatactatggatacctccgggttttgcccatggattt
caagcattagaagattcaatagtagtctacttcctaactcacaacgaatactctaaatct
cacgagagatgcgtaaactactcttatgtagactggccaataaaggaatttattataagc
gataaggatttacaatgcccgcccttagaaaaggcagaagtctttaagtga

DBGET integrated database retrieval system