KEGG   Sulfolobus islandicus M.16.27: M1627_1030Help
Entry
M1627_1030        CDS       T00900                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sim00523]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of vancomycin group antibiotics
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sim00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1007594..1008544)
Genome map
AA seq 316 aa AA seqDB search
MKIAVLGGAGFIGSAFVRELNKRGIRPIVIDLLTYAGRVENLKDTDHEFIKADIRDQKLH
DILREHKVEVVINFAAESHVDRSIYKPQDFVTTNVLGTINVLEAARRFNFNYVHISTDEV
YGEECGDEDSPLNPSSPYSASKASADLFVKSYVRTYDVKAIIVRPSNNFGPRQFPEKLIP
KAIIRTFLGLHVPIYGDGKQERDWIFVEDTARIIADLIDKAEWRREVYNIPGKQRVSNLE
LVKLLSEVMGKEVRIKFVSNRPGHDRRYCMNTKLSYEVTPLKEGLRKTYEWYISNEWWWR
PLIDDKFFKEDEPWKS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagttttaggaggggccggatttataggctctgcctttgtaagggaatta
aataagagggggataaggccaatagttatagacctcttaacttacgccggcagagttgag
aacttaaaggacaccgatcacgaatttattaaagctgatataagggatcagaaacttcat
gatattttgagggaacataaggtagaagttgtaattaatttcgcagcagaatctcacgtt
gataggtctatttataaaccccaggatttcgtaactacgaacgttttagggacgataaac
gttttagaagctgctaggcgttttaattttaattacgttcatatatcaacggacgaagtt
tacggtgaggagtgcggtgatgaggactcaccgttaaacccatcatcaccttatagcgca
tctaaggcttcagctgatttgtttgttaaatcttacgttaggacttatgacgttaaggct
attattgttaggccttcaaacaatttcggtcctagacagttcccggaaaaattaatacct
aaagcaattattaggactttcctcggtttacacgttccgatttacggtgacggtaagcag
gagagggattggatattcgtagaagatactgcaaggataattgctgatttaatagataag
gctgagtggagaagagaagtttataatatcccagggaagcagagggttagtaatcttgag
ttggttaagttattaagtgaggttatgggaaaagaggttaggattaagttcgtttctaat
agaccgggacacgataggaggtattgtatgaatactaagctttcttatgaagtcactcct
cttaaggagggtttgagaaagacttatgagtggtatattagtaatgagtggtggtggagg
ccattaattgatgacaagttctttaaggaagatgaaccgtggaagagctaa

DBGET integrated database retrieval system