KEGG   Sulfolobus islandicus M.16.27: M1627_1932Help
Entry
M1627_1932        CDS       T00900                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00030  Pentose phosphate pathway
sim00051  Fructose and mannose metabolism
sim00680  Methane metabolism
sim01100  Metabolic pathways
sim01110  Biosynthesis of secondary metabolites
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
sim01200  Carbon metabolism
sim01230  Biosynthesis of amino acids
Module
sim_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_1932
   00030 Pentose phosphate pathway
    M1627_1932
   00051 Fructose and mannose metabolism
    M1627_1932
  Energy metabolism
   00680 Methane metabolism
    M1627_1932
Enzymes [BR:sim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     M1627_1932
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     M1627_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACP55803
JGI: KislK21932
UniProt: C3MZH1
Position
1807329..1808477
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNVISDYYITYVGDDLQLIMTH
NRGELDTKVHETAWNAFKEAAKVAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEMEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIIL
NTPEETYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLVGLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtgatcaaagccgatataggaagcctagctggacatcatgtt
gttcatcctgatactatagctgcagctaataagatattagcagaagctaaaaggaataac
gtaatttccgattattacataacttatgttggagacgatttacaattaataatgactcat
aatagaggagaactagatactaaagttcatgaaacagcctggaatgcctttaaagaagct
gcgaaagtagctaaggatttaggattatatgctgcagggcaagatttgctttcagattcc
ttttctggaaatcttagaggaatgggtcctggaattgctgaaatggaatttgaggagaga
cctgctgaaccagtggttatttttatggctgataagactgagcctggtgcatataatcta
ccattatataaaatatttgcagacccattcaatactgctgggctagtaatagatccaaca
atgcatgaaggatataaatttgaagttttagatgtatatgaaggagagtcaataatttta
aacacaccagaagagacttacgatctacttgcgttaataggaacccctagcagatacatt
gttagaagagtttatagaaaggccgataatttacaagcctcagttgtttctgtagaaaga
ttgaatctaatagctggcaaatacgtaggcaaagacgatccagttatggtagtaagagct
caacacggtttgcctgcgttaggagaaatcttagaagcatttacagtaccttatttggta
ccggggtggatgagaggtagtcactatggacctcttatgccagtatcacaaaaggatgcg
agagccacaaggttcgatggtcctcctaggttagtaggtttaggatttaacatcaaaaat
gggaaactagtagggcctactgatttatttgatgatcctgcatttgatgaggtaaggaga
acagctgtaataattgcagattacattaggaaacatggcccatttatgcctcatagatta
gagccacaagaaatggagtacaccacactcccattagtaatagagaagttgaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttcg
catgaataa

DBGET integrated database retrieval system