KEGG   Sulfolobus islandicus M.16.27: M1627_2005Help
Entry
M1627_2005        CDS       T00900                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00030  Pentose phosphate pathway
sim00051  Fructose and mannose metabolism
sim00052  Galactose metabolism
sim00230  Purine metabolism
sim00500  Starch and sucrose metabolism
sim00520  Amino sugar and nucleotide sugar metabolism
sim00521  Streptomycin biosynthesis
sim01100  Metabolic pathways
sim01110  Biosynthesis of secondary metabolites
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_2005
   00030 Pentose phosphate pathway
    M1627_2005
   00051 Fructose and mannose metabolism
    M1627_2005
   00052 Galactose metabolism
    M1627_2005
   00500 Starch and sucrose metabolism
    M1627_2005
   00520 Amino sugar and nucleotide sugar metabolism
    M1627_2005
  Nucleotide metabolism
   00230 Purine metabolism
    M1627_2005
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M1627_2005
Enzymes [BR:sim01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     M1627_2005
    5.4.2.8  phosphomannomutase
     M1627_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Propep_M14
Motif
Other DBs
NCBI-ProteinID: ACP55875
JGI: KislK22005
UniProt: C3MZP3
Position
1872964..1874331
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTDGIRGVTNTELQPEFALKLGKAIGTYFGKGARILIGRDVRAGGDMLLKAVESG
LLSSGVLVYEAGMAPTPAFQYGVKTLGYDGGIIITASHNPAEYNGIKVLSPHGIEIARED
EDKIEDIYFNNKFHVVEWNGLVNDVKREDKVIETYVQGILSHVDADKIRSKKYKVLIDPA
NSVGTLATPIVARELGCKVFTINGNLDPLFSARTPEPTFESLSESAKVAKQLGVDLAVAH
DGDADRAIFIDSMGRVQWGDRSGTLLSYWASIKAPNLPKRIFTAVSSSSLVEEYLKQYNI
EVKWTKVGSVDIAHALFKEKGVAGFEENGGFMYPPHQAVRDGAMSFALMLEMMASENENS
TELFNRLPVYYLVKTKVRITEKSNINKIYDEIIDKYGKYGNIVTIDGVKIISNDFWLLVR
KSGTEPIIRILVEAKDENKSKELAKELEKLVSELA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttatttggaacggatggaataagaggagttactaatactgaattgcaacca
gaatttgcgttaaaattaggaaaagctataggaacatatttcggtaaaggtgctagaatt
ctaataggcagggatgtaagagctggaggagatatgttacttaaagccgttgagagtgga
ttgttaagtagtggcgtattggtctatgaagctgggatggctcctactccagctttccag
tacggtgtaaaaactttaggatatgacggtggtattataataaccgctagtcataatcca
gctgaatataatggtatcaaagtcctttctccacatggtattgagatagctagggaagac
gaggataaaatagaagatatatactttaataataaatttcatgtagtagaatggaatggt
ttagtaaatgatgtaaaaagagaagataaagttattgaaacttacgtgcaagggatactc
tctcatgttgatgctgataaaattaggagtaaaaagtataaggttctcatagaccctgct
aatagtgtaggtacattggcaacaccaattgttgcgagggagttgggatgtaaagttttt
actatcaatgggaatttagatcctctattttcagctagaacaccagaacccacatttgag
agtcttagtgagagtgcaaaagttgctaaacaactaggcgtggatttggcagtagctcat
gatggtgacgcggatagggcaattttcatagactccatggggagagttcaatggggtgat
agaagcggtactttattgtcatattgggcttcgataaaagctccaaatctgcctaagcgt
atatttactgcagtttctagctctagcttagttgaagaatatctaaaacagtacaatata
gaggttaagtggactaaggtaggtagtgtagacattgcacatgctctatttaaggaaaaa
ggagtagcgggatttgaggaaaatggtggatttatgtatcctcctcatcaagcagtaaga
gacggtgcaatgtcattcgctttaatgctggaaatgatggcatctgagaatgaaaactct
actgaattatttaatagactccctgtttattatttagtgaaaacaaaagtaagaattacg
gaaaagagtaatataaataagatttatgacgaaataatagataagtacggaaagtacggg
aatatagttacaatagatggtgttaagattattagcaacgatttctggctcctagttagg
aagagtggtacagagccaataataagaatattagtcgaggcaaaagatgagaataaatca
aaagaattagctaaagaattagaaaagttggtgagtgagttagcgtga

DBGET integrated database retrieval system