KEGG   Sulfolobus islandicus M.16.27: M1627_2521Help
Entry
M1627_2521        CDS       T00900                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sim01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sim00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sim00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sim00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sim00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sim00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2370973..2372973
Genome map
AA seq 666 aa AA seqDB search
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTL
DDSNPPFYKWFVGGELNASYLTIDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYD
LYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLAAARIGVVFTVVFSGFSADAL
ASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKW
VFDIRDDDIYWCTADIGWVTGHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGI
TILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPINPEAWEWLWKLVGREEVPFGS
TWWMTETGGILISHLPGLYLVPMKPGTNGPPILGIEPDVVNEDGKQVNPEERGYLVIKNP
WPGMPLTIYKDPERYVKVYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGT
YELESALIEHPAVAEAAVIGVPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGP
IATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITTLEDEASVEEIKKALEEFKAE
FEKINK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaacgtgggctctaccttttgatcaaaagataaacccaaaactgaatttaaat
aggctagtaagtataactacgtataaagagattcacagccaaacggtaaaagattacaaa
caattttgggcatctgtagcctcggaaattgactggttcaaaccatgggagaaaacacta
gacgatagtaatcctccattctataagtggttcgtaggtggagagcttaacgcctcttat
ctaactatagataggcacgttaagagctggaggaagaataaggttgccataatatgggaa
ggagaaccagtggacgagaagggaaacccaaaggaggttaggaagttaacatattacgat
ctatatagggaagttaatagagtagcctatctcttgaaggagaaatacgggttaaagaaa
ggtgatgcaatagcgatttaccttccaatgataccggaattaccaatattcatgttagct
gctgctaggatcggagtagtctttacggtggtgttctcaggatttagcgctgacgcattg
gcaagtaggattaatgacgccgaagccaagttactaattaccgcagatggtggatggaga
aggggtaaagttgttgacttaaagggaattgtagataaggctttggagaagaccccaaca
ataaaggatgtaatagtagttagaaggataggtaataaggtcaacatggttgaaggtagg
gataagtactttgatgaagtaatcaaggacattccacaaaatgtttacgttgaaccagaa
aggatgaaatctgaagacccgttatatatactctacacctctggaaccactggaaaacct
aagggtatagtccacgatattggagggtatatgacattattacacgctacaatgaagtgg
gtattcgatataagggatgacgacatttactggtgtaccgcagatataggatgggttact
ggacactcttacattgtgtttggaccattaatggaaggagcaactgaaataatgtatgaa
ggagccttggattatccacaaccagataggtgggtatcgataattgaaaggtatgggatc
acaatcctttatacctcacccactgcaattagaagcttcatgaaatatggcgataattgg
gttaaggctcacattacctccactgttaggctaatgcattctgtaggtgaaccaataaat
ccggaagcttgggagtggctatggaaattagtcggtagagaggaggtaccatttggaagc
acttggtggatgactgagactggaggtattctaatatctcatttaccaggattgtatctt
gtgccaatgaaacctgggacaaatggcccaccaatattgggaattgagccagatgtagtt
aatgaagatgggaaacaagttaaccctgaggaaagaggatatcttgttataaagaatccg
tggcctggaatgccattaacaatttacaaggatcctgaaagatacgtgaaggtgtattgg
agtagattccctggaatgttctatgttggtgattacgctgttaaggacaaggatggatac
ttctggatattagggagggctgatgaagttatcaaggtagctgggcataggttaggtaca
tatgagttagaatcagctttaattgagcatcctgcagttgcggaagcagcggtaattgga
gtcccagacccagttaagggagaggtaccttatgcgtttgtaattttgaggcaaggttat
acacctaatacgcagctttcacaagagatactgaagacggtaagagataaggtgggacct
atagctactatagataagatattcttcgtgggtaagttgcctaaaacgagaagtggaaag
ataatgagaagagttgtaagggctgttgcaactagggcagaagtgggagatataactaca
ctggaggatgaggcttctgtagaggagattaaaaaagctttagaggagtttaaggcagag
tttgaaaagattaacaaataa

DBGET integrated database retrieval system