KEGG   Sulfolobus islandicus M.16.27: M1627_2620Help
Entry
M1627_2620        CDS       T00900                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00020  Citrate cycle (TCA cycle)
sim00620  Pyruvate metabolism
sim00640  Propanoate metabolism
sim00650  Butanoate metabolism
sim00680  Methane metabolism
sim00720  Carbon fixation pathways in prokaryotes
sim01100  Metabolic pathways
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
sim01200  Carbon metabolism
Module
sim_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_2620
   00020 Citrate cycle (TCA cycle)
    M1627_2620
   00620 Pyruvate metabolism
    M1627_2620
   00640 Propanoate metabolism
    M1627_2620
   00650 Butanoate metabolism
    M1627_2620
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1627_2620
   00680 Methane metabolism
    M1627_2620
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    M1627_2620
Enzymes [BR:sim01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     M1627_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_2 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_17 Fer4_15 Fer4_22 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACP56457
JGI: KislK22620
UniProt: C3N2W0
Position
2469241..2469525
Genome map
AA seq 94 aa AA seqDB search
MNKLVLSMSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNNCIGCKACFMFCPESTIV
PSNGKVRVDYEYCKGCGVCANVCPVKAISMVNEQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttggtgttgagtatgtcactgcttgaatatcaatactttcctgtaactaga
cccaataagggtgctggaggaagaactggagcatggagaatagtaaaacctgttgttgat
tataacaattgcataggctgtaaagcgtgttttatgttttgcccagaatccacaatagtc
cctagcaatggtaaggtaagagtggattatgagtattgcaaaggctgtggagtttgtgcc
aatgtatgcccagttaaggctataagtatggtgaatgagcaatga

DBGET integrated database retrieval system