KEGG   Sulfolobus islandicus M.16.27: M1627_2621Help
Entry
M1627_2621        CDS       T00900                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00020  Citrate cycle (TCA cycle)
sim00620  Pyruvate metabolism
sim00640  Propanoate metabolism
sim00650  Butanoate metabolism
sim00680  Methane metabolism
sim00720  Carbon fixation pathways in prokaryotes
sim01100  Metabolic pathways
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
sim01200  Carbon metabolism
Module
sim_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_2621
   00020 Citrate cycle (TCA cycle)
    M1627_2621
   00620 Pyruvate metabolism
    M1627_2621
   00640 Propanoate metabolism
    M1627_2621
   00650 Butanoate metabolism
    M1627_2621
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1627_2621
   00680 Methane metabolism
    M1627_2621
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    M1627_2621
Enzymes [BR:sim01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     M1627_2621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N SHOCT
Motif
Other DBs
NCBI-ProteinID: ACP56458
JGI: KislK22621
UniProt: C3N2W1
Position
2469522..2470724
Genome map
AA seq 400 aa AA seqDB search
MIRKVISGNEAVALGVKLARVGVTGIYPITPQTTIIEKLAEMRAKGEIETEIVRVESEHS
AMAATFGAALGGVRAFTATASQGLLYMHEMIWWVAGSRVPVVMVVGTRAVGAPWNIWNEH
TDFTSERDSGWIMAFASNPQEALDLTLQAFRISEDERVFLPMMVGMDGFILSHTKTNVLI
PDQDQVDEFLPPRRQPYVIDPEDPIGMGNIFPPEGYMRLRESIDLALRNSENIIKEIGRE
YNKKINPLGDYSTLNVSYKLEDADYAIVLMGAWAGDAMEAVDTLREKGIKIGMLRIRYLR
PWSEKEIRNALKDKRAVLVLDRSTSFGRGGGPLYVEVKSTISDIVPQVKGVVSGLGGVTV
NKSELLYIFNKFVEGLKDDVIWYYPKEVGKIEFRTPRDIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaggttatttctggaaatgaagctgttgcgttaggtgtgaaactagcgaga
gtaggagttacaggaatatacccaataacgccacaaactacgataattgagaaattagct
gagatgagagctaaaggtgaaattgaaaccgaaatagtgagagttgaaagtgagcactcg
gcaatggctgcaacgttcggtgctgctttaggtggtgttagggcttttactgctaccgca
tcgcaaggcttgctttacatgcatgaaatgatttggtgggtggctgggagtagagtacca
gtagtaatggttgtaggtactagagcagtaggagctccttggaacatttggaatgagcat
accgactttacaagtgagagggatagtggatggataatggcttttgcatccaatccgcaa
gaagcattagatctaactttacaagcgtttaggatttcagaggatgagagagtattctta
ccaatgatggtcggtatggatggattcatcctttcgcatactaagactaatgtactaata
cccgatcaagatcaagtagacgaattcttacctccaaggagacagccatatgtgatagat
ccagaggacccaataggtatgggtaacatattccctccggagggctatatgagactaagg
gaatcaatagatttagcacttagaaattcagagaatataataaaagaaataggaagagaa
tataataagaaaattaatccattaggagattactccacactaaatgtgtcgtataaacta
gaagatgcggattacgcaatagttttaatgggagcttgggcaggagatgccatggaggct
gtagatacattaagggagaaggggataaaaataggcatgttaagaataaggtatcttaga
ccttggagtgagaaggagataagaaatgcgttgaaggataaaagggctgttctagtgtta
gatagaagtacgagttttggtaggggtggaggaccactttacgttgaagtaaagtccaca
atatcggacattgtaccacaggtaaaaggtgtagtgagtgggttgggaggtgttacagtt
aacaagagcgagttattgtatatatttaacaagtttgtagaaggcttaaaggatgacgta
atttggtattatccaaaggaggtggggaagattgagtttaggactccgagagatattgaa
taa

DBGET integrated database retrieval system