KEGG   Sulfolobus islandicus M.16.27: M1627_2622Help
Entry
M1627_2622        CDS       T00900                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00010  Glycolysis / Gluconeogenesis
sim00020  Citrate cycle (TCA cycle)
sim00620  Pyruvate metabolism
sim00640  Propanoate metabolism
sim00650  Butanoate metabolism
sim00680  Methane metabolism
sim00720  Carbon fixation pathways in prokaryotes
sim01100  Metabolic pathways
sim01120  Microbial metabolism in diverse environments
sim01130  Biosynthesis of antibiotics
sim01200  Carbon metabolism
Module
sim_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1627_2622
   00020 Citrate cycle (TCA cycle)
    M1627_2622
   00620 Pyruvate metabolism
    M1627_2622
   00640 Propanoate metabolism
    M1627_2622
   00650 Butanoate metabolism
    M1627_2622
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1627_2622
   00680 Methane metabolism
    M1627_2622
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    M1627_2622
Enzymes [BR:sim01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     M1627_2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C E1_dh Peptidase_M24_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ACP56459
JGI: KislK22622
UniProt: C3N2W2
Position
2470693..2471592
Genome map
AA seq 299 aa AA seqDB search
MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDMVLVVVAGCSSVIQGNAPY
NAYNFPTVNVAFAAGPATAAGLARAYKQRGKNVTVVVWAGDGGSADIGFASLSGAAERND
NILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNLPLLMIAHNVPYVATASV
GYPHDYIEKLKKAKQVEGFKYIHVLTPDPYGWLFDPSKTAEVAKLAVQTCYWPLFEYYNG
KLSISSESLHCLDRRTRRPIRDFLSVQGRFKRLTEDQIKILEQYIDNVWEKLKSMLDNQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaggactccgagagatattgaataagcataatggtatcttatccgggacttca
gcttgtcctggctgcccagagaatatggcaatgagaatgctaggaatgggactaggtaaa
gatatggttctagtagtagttgcgggatgttcctcagtaatacaaggaaatgcgccttat
aatgcttacaacttccctactgtgaacgttgcctttgcggctggtccagctacggctgct
ggtttggctagagcgtataaacaaagaggtaagaatgtcactgtagtggtttgggctgga
gatggaggaagtgctgatataggatttgcatcattaagcggagctgctgagagaaatgat
aatatactctaccttactgtggataacgaggcctatatgaatagtggagggcagagaagt
ggctcaactccctttggagcaattactactacaactccagagggaaaaaaggaaaataag
aaaaacttgccattattaatgatagcgcataacgtaccttatgtggctactgcatctgta
ggatatccacatgattatatagagaagttaaagaaagccaagcaagtcgaaggtttcaaa
tatattcacgtcctaactcctgatccttacggttggttatttgatccttcaaaaactgct
gaagtggcaaaattggcagtacagacttgctattggcccctctttgaatactataatgga
aaattaagcattagttcagaaagtttacattgtcttgacagaagaactagaagacctata
agagactttctgagtgttcaaggaagattcaagagattgacagaggatcaaataaagatt
ttagagcaatatatagataacgtgtgggagaagttaaaatccatgctcgataatcagtaa

DBGET integrated database retrieval system