KEGG   Sulfolobus islandicus M.16.27: M1627_2645Help
Entry
M1627_2645        CDS       T00900                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
sim  Sulfolobus islandicus M.16.27
Pathway
sim00330  Arginine and proline metabolism
sim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sim00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M1627_2645
Enzymes [BR:sim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     M1627_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF2396
Motif
Other DBs
NCBI-ProteinID: ACP56482
JGI: KislK22645
UniProt: C3N2Y5
Position
2493392..2494309
Genome map
AA seq 305 aa AA seqDB search
MRQIDALKSPRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGS
RLLRPYNQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQTNLYEIISSKNLVPFIAGG
DHSITLPVLRALNKKYGKINIIHLDSHYDFWDSYWGKKHTHGTWLRRAIEEGLIKEAIQG
GIRASTFSKEDLKDKERLGVKSFTIRDLKYNLDSVIREINSLSGPTHVSIDIDVVDPAFA
PGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSV
LSLNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaatagacgcgttaaaatctccacgcttcacacaaatttctaccttcggtaga
ttaccaatttgcggaagagatgaggaaataaaggcggcgtttttaggaatacctttcgat
gatgctgtaacttatagaccgggagccagatttggaccaatgggaataagacaaggatct
agattattaagaccttacaatcaattcctagatacttatccttttgataagcttaacgct
tgtgatatgggtgatataaacattattccggggtacattgaggatacaatgaacataata
caaacgaatctttacgaaataatatcatcaaaaaacctagtgccctttatagctggtgga
gatcactcaatcacgttacccgttttaagggctttaaataagaagtatggaaaaataaat
atcatacacttggattcacattacgacttctgggattcctattggggtaagaaacatacg
catggtacgtggttgaggagggcaattgaagagggcttaatcaaagaagctatacaagga
ggaattagggcctcaacgttctcgaaagaagatcttaaagataaggagaggttaggagtg
aagagtttcacaattagagatttaaagtataatttagattctgttataagggaaataaat
tccctatctggtcccacacacgtttccattgatatagatgttgtagatccggcgtttgcc
cctgggactggtacgccagaagtgggtggtttgacaagcttcgaaattatagaaattatc
agaaagctgagatttgataaactagttggatttgatgttgtagaagttgccccaccatat
gatgtaagcgaaatcaccacaatgttagctgcgaatattatctatgaaggaatgagcgta
ctctcactaaatctttaa

DBGET integrated database retrieval system