KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_0074Help
Entry
YN1551_0074       CDS       T00902                                 

Definition
hypothetical protein
Organism
sin  Sulfolobus islandicus Y.N.15.51
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
65883..66524
Genome map
AA seq 213 aa AA seqDB search
MSDKEELSAKLRIILRDIRYLTILKHLKIANVDYGKSIMLNTRIPLAEIVEILDDLERLG
LIERVHGATLKNTEAKFKLSSEVHKHHTYYRLTREGDHLLRHLEDRMLIDAYMEIVKNDN
LALNILRLADELNADHALTYAKLTHKRLEEITPKIEELVKMGLLEEKNSKIIKFADRKAK
PKKETRTHHKYYGLSRIGELVVREMKRRGILPK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaagaggaattaagtgctaaacttaggataatattgagagatataagatat
cttactattctaaaacacttgaaaattgctaatgtagactatggtaagtcgataatgcta
aacaccaggattccattggctgagatagttgagatattggatgatcttgaaagattaggt
ttaatagagagagttcacggtgcaaccctaaagaatactgaagccaaatttaagcttagt
tctgaggtacataagcatcacacgtattataggctcaccagagaaggagatcatctatta
aggcatttagaagatagaatgttgatcgatgcatatatggagatcgtcaaaaatgataat
ctagcgttaaatattcttagactggcagatgaacttaacgcagatcatgccctaacgtat
gcaaaattgactcataagaggctagaagagattacaccaaagattgaggagctagttaag
atgggattattagaagaaaagaattcgaaaataattaaatttgccgatagaaaagccaag
ccgaaaaaggaaacaaggactcaccataaatattacggtctgtcaaggattggagaattg
gtggttagggagatgaaaagaagggggattttacctaagtaa

DBGET integrated database retrieval system