KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_0159Help
Entry
YN1551_0159       CDS       T00902                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00010  Glycolysis / Gluconeogenesis
sin00020  Citrate cycle (TCA cycle)
sin00620  Pyruvate metabolism
sin00640  Propanoate metabolism
sin00650  Butanoate metabolism
sin00680  Methane metabolism
sin00720  Carbon fixation pathways in prokaryotes
sin01100  Metabolic pathways
sin01120  Microbial metabolism in diverse environments
sin01130  Biosynthesis of antibiotics
sin01200  Carbon metabolism
Module
sin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YN1551_0159
   00020 Citrate cycle (TCA cycle)
    YN1551_0159
   00620 Pyruvate metabolism
    YN1551_0159
   00640 Propanoate metabolism
    YN1551_0159
   00650 Butanoate metabolism
    YN1551_0159
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YN1551_0159
   00680 Methane metabolism
    YN1551_0159
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YN1551_0159
Enzymes [BR:sin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     YN1551_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_15 Fer4_17 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACP47353
JGI: SislY20159
UniProt: C3NJV1
Position
complement(140680..140943)
Genome map
AA seq 87 aa AA seqDB search
MSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNKCIGCKVCFMFCPESTIVPSNGKVR
VDYEYCKGCGVCANVCPVKAISMVNEQ
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcttgaatatcaatactttcctgtaactagacccaataagggtgctggagga
agaactggagcatggagaatagtaaaacctgttgttgattataacaagtgcataggctgt
aaagtgtgttttatgttttgcccagaatccacaatagtccctagcaatggtaaggtaaga
gtggattatgagtattgcaaaggctgtggagtttgtgccaatgtatgcccagttaaggct
ataagtatggtgaatgagcaatga

DBGET integrated database retrieval system