KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_0311Help
Entry
YN1551_0311       CDS       T00902                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YN1551_0311
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YN1551_0311
   00620 Pyruvate metabolism
    YN1551_0311
   00640 Propanoate metabolism
    YN1551_0311
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YN1551_0311
   00680 Methane metabolism
    YN1551_0311
Enzymes [BR:sin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YN1551_0311
Lipid biosynthesis proteins [BR:sin01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YN1551_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(277113..279113)
Genome map
AA seq 666 aa AA seqDB search
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTL
DDSNPPFYKWFVGGELNASYLTVDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYD
LYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLAAARIGVVFTVVFSGFSADAL
ASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKW
VFDIRDDDIYWCTADIGWVTGHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGI
TILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPINPEAWEWLWKLVGREEVPFGS
TWWMTETGGILISHLPGLYLVPMKPGTNGPPILGIEPDVVNEDGKQVNLEERGYLVIKNP
WPGMPLTIYKDPERYVKAYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGT
YELESALIEHPAVAEAAVIGVPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGP
IATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITALEDEASVEEIKKALEEFKAE
FEKINK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaacgtgggctctaccttttgatcaaaagataaacccaaaactgaatttaaat
aggctagtaagtataactacgtataaagagattcacagccaaacggtaaaagattacaaa
caattttgggcatctgtagcctcggaaattgactggttcaaaccatgggagaaaacacta
gacgatagtaatcctccattctataagtggttcgtaggtggagagcttaacgcctcttat
ctaactgtagataggcacgttaagagctggaggaagaataaggttgccataatatgggaa
ggagaaccagtggacgagaagggaaacccaaaggaggttaggaagttaacatattacgat
ctatatagggaagttaatcgagtagcctatctcttgaaggagaaatacgggttaaagaaa
ggtgatgcaatagcgatttaccttccaatgataccggaattaccaatattcatgttagct
gctgctaggatcggagtagtctttacggtggtgttctcaggatttagcgctgacgcattg
gcaagtaggattaatgacgccgaagccaagttactaattaccgcagatggtggatggaga
aggggtaaagttgttgacttaaagggaattgtagataaggctttggagaagaccccaaca
ataaaggatgtaatagtagttagaaggataggtaataaggtcaacatggttgaaggtagg
gataagtactttgatgaagtaatcaaggacattccacaaaatgtttacgttgaaccagaa
aggatgaaatctgaagacccgttatatatactctacacctctggaaccactggaaaacct
aagggtatagtccacgatattggagggtatatgacattattacacgctacaatgaagtgg
gtattcgatataagggatgacgacatttactggtgtaccgcagatataggatgggttact
ggacactcctacattgtgtttggaccattaatggaaggagcaactgaaataatgtatgaa
ggagccttggattatccacaaccggataggtgggtatcgataattgaaaggtatgggatc
acaatcctttatacctcacccactgcaattagaagcttcatgaaatatggtgataattgg
gttaaggctcacattacctccactgttaggctaatgcattctgtaggtgaaccaataaat
ccggaagcttgggagtggctatggaaattagtcggtagagaggaggtaccatttggaagc
acttggtggatgactgagactggaggtattctaatatctcatttaccaggattgtatctt
gtgccaatgaaacctgggacaaatggcccaccaatattgggaattgagccagatgtagtt
aatgaagatgggaaacaagttaaccttgaggaaagaggatatcttgttataaagaatccg
tggcctggaatgccattaacaatttacaaggatcctgaaagatacgtgaaggcgtattgg
agtagattccctggaatgttctatgttggtgattacgctgttaaggacaaggatggatac
ttctggatattagggagggctgatgaagttatcaaggtagctgggcataggctaggtaca
tatgagttagaatcagctttgattgagcatcctgcagttgcggaagcagcggtaattgga
gtcccagacccagttaagggagaggtgccttatgcgtttgtaattttgaggcaaggttat
acacctaatacgcagctttcacaagagatactgaagacggtaagagataaggtgggacct
atagctactatagataagatattcttcgtgggtaagttgcctaaaacgagaagtggaaag
ataatgagaagagttgtaagggctgttgcaactagggcagaagtgggagatataactgca
ctggaggatgaggcttctgtagaggagattaaaaaagctttagaggagtttaaggcagag
tttgaaaagattaacaaataa

DBGET integrated database retrieval system