KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_0811Help
Entry
YN1551_0811       CDS       T00902                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K05829  LysW-gamma-L-alpha-aminoadipyl-6-phosphate/LysW-L-glutamyl-5-phosphate reductase [EC:1.2.1.-]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00220  Arginine biosynthesis
sin00300  Lysine biosynthesis
sin01100  Metabolic pathways
sin01110  Biosynthesis of secondary metabolites
sin01210  2-Oxocarboxylic acid metabolism
sin01230  Biosynthesis of amino acids
Module
sin_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
sin_M00763  Ornithine biosynthesis, mediated by LysW, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YN1551_0811
   00220 Arginine biosynthesis
    YN1551_0811
Enzymes [BR:sin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     YN1551_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC Epimerase
Motif
Other DBs
NCBI-ProteinID: ACP47936
JGI: SislY20811
UniProt: C3NF40
Position
736572..737630
Genome map
AA seq 352 aa AA seqDB search
MKDRVRVAVVGGSGYTGGELLRILVTHPKTEISAITSREYAGKPVSLVHPNLRGLLSLNF
TNFSIDKISDKADAIFLALPHGVSLNYVPKLLDLGLTVVDLSADFRLKNPELYKIWYNYE
HPYPDLLDKAVYGLPELHFEELRNAKLIASPGCNATATILALAPVVASKITDEKKFISDV
KVGSSEGGAKPSEGSHHPERQNAIRPYEAEGHRHAAEAEQELSRIAKVNISVSIVPHAVS
SIRGALASAHTWLSNEIEEIEIWKKIAEFYRGKRFIRIVRGNIHPYPDPKFVIGSNFGDI
GFAVEKRISRLTAFSAIDNLMKGAAGQAVQAFNISMGFNEDDGLKLVPLRPA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagagttagagttgccgtagtgggaggttcaggatacacgggtggagagtta
ctaagaatactagttacacatccgaagacagaaatatcagccataacttctagagaatat
gcaggaaaaccggtatcattggtacatccgaatttaagagggctattatcgcttaatttc
acaaatttctcgatagataaaatctcagacaaagccgacgcaatttttcttgctctacca
catggagtatcgctaaattacgtacccaaattactggatttaggattaacggtagtggat
ttgagtgcagattttagactcaagaatcccgaactttataaaatatggtataactatgaa
catccttacccagatctattagacaaagcagtatatggactaccagagttgcatttcgag
gaattaagaaatgctaaacttatagcttccccaggatgcaatgccacagcaacaatacta
gcactagccccagttgtagcatcaaaaataactgatgagaaaaagtttatcagtgatgta
aaggtaggcagtagtgaagggggagctaaaccttcagaaggaagtcatcatccggagaga
caaaatgcaattagaccttatgaagccgaaggacacagacatgcagcagaagctgaacaa
gaactgtccagaatagctaaagtgaatataagcgtaagtattgtccctcatgctgtgagc
agcatcagaggggctttagcatctgcacatacatggttatctaatgagatagaagagatt
gaaatatggaaaaaaatagccgaattttatagaggcaagagattcatcagaatagttaga
ggtaatatacacccatatcctgatccaaaattcgttatcggaagcaacttcggtgacata
ggatttgctgtagaaaaaagaatttcaagactaacagcattctcagctatagataacttg
atgaagggtgcggctggccaggctgtccaagcctttaatatctctatgggatttaacgaa
gatgatggattaaaactagtacccttgaggcctgcctaa

DBGET integrated database retrieval system