KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_0811Help
Entry
YN1551_0811       CDS       T00902                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38)
Orthology
K05829  
N-acetyl-gamma-glutamyl-phosphate/LysW-gamma-L-alpha-aminoadipyl-6-phosphate reductase [EC:1.2.1.38 1.2.1.-]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Lysine biosynthesis
Arginine and proline metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    YN1551_0811 (argC)
   01230 Biosynthesis of amino acids
    YN1551_0811 (argC)
  Amino acid metabolism
   00300 Lysine biosynthesis
    YN1551_0811 (argC)
   00330 Arginine and proline metabolism
    YN1551_0811 (argC)
Enzymes [BR:sin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     YN1551_0811 (argC)
    1.2.1.-  
     YN1551_0811 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
736572..737630
Genome map
AA seq 352 aa AA seqDB search
MKDRVRVAVVGGSGYTGGELLRILVTHPKTEISAITSREYAGKPVSLVHPNLRGLLSLNF
TNFSIDKISDKADAIFLALPHGVSLNYVPKLLDLGLTVVDLSADFRLKNPELYKIWYNYE
HPYPDLLDKAVYGLPELHFEELRNAKLIASPGCNATATILALAPVVASKITDEKKFISDV
KVGSSEGGAKPSEGSHHPERQNAIRPYEAEGHRHAAEAEQELSRIAKVNISVSIVPHAVS
SIRGALASAHTWLSNEIEEIEIWKKIAEFYRGKRFIRIVRGNIHPYPDPKFVIGSNFGDI
GFAVEKRISRLTAFSAIDNLMKGAAGQAVQAFNISMGFNEDDGLKLVPLRPA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagagttagagttgccgtagtgggaggttcaggatacacgggtggagagtta
ctaagaatactagttacacatccgaagacagaaatatcagccataacttctagagaatat
gcaggaaaaccggtatcattggtacatccgaatttaagagggctattatcgcttaatttc
acaaatttctcgatagataaaatctcagacaaagccgacgcaatttttcttgctctacca
catggagtatcgctaaattacgtacccaaattactggatttaggattaacggtagtggat
ttgagtgcagattttagactcaagaatcccgaactttataaaatatggtataactatgaa
catccttacccagatctattagacaaagcagtatatggactaccagagttgcatttcgag
gaattaagaaatgctaaacttatagcttccccaggatgcaatgccacagcaacaatacta
gcactagccccagttgtagcatcaaaaataactgatgagaaaaagtttatcagtgatgta
aaggtaggcagtagtgaagggggagctaaaccttcagaaggaagtcatcatccggagaga
caaaatgcaattagaccttatgaagccgaaggacacagacatgcagcagaagctgaacaa
gaactgtccagaatagctaaagtgaatataagcgtaagtattgtccctcatgctgtgagc
agcatcagaggggctttagcatctgcacatacatggttatctaatgagatagaagagatt
gaaatatggaaaaaaatagccgaattttatagaggcaagagattcatcagaatagttaga
ggtaatatacacccatatcctgatccaaaattcgttatcggaagcaacttcggtgacata
ggatttgctgtagaaaaaagaatttcaagactaacagcattctcagctatagataacttg
atgaagggtgcggctggccaggctgtccaagcctttaatatctctatgggatttaacgaa
gatgatggattaaaactagtacccttgaggcctgcctaa

DBGET integrated database retrieval system