KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_0842Help
Entry
YN1551_0842       CDS       T00902                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YN1551_0842
Enzymes [BR:sin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     YN1551_0842
Exosome [BR:sin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YN1551_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
760847..761857
Genome map
AA seq 336 aa AA seqDB search
MVTFPFLRPRRLRKNKLVRDLVAETTLFQDDLVLPIFIKESINEPEQITSMPGVYRYPPN
DKLVNYVQDSYENGIRSIILFGIPSYKDEIASSAYDKNGVIQRAVKIIKDSFKDKIIVIT
DECTDEYTSHGHCGLVNYNNGCYVIDNDESLKIHAKIALSQAEAGADIIAPSSMMDGVVK
AIRDALDGAGYNDTLIMSYSVKYASIMYGPFRDAAYSKPAFGDRRGYQMDPRNAFEALKE
ARLDIEEGADILMVKPAHTYLDVIRLVKDHFPEYPLAAYHVSGEYSMIKAAAINGWIDER
TAVLEITTAIKRAGADLIITYYANDIVRWIKEGVPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattcccatttttgagaccaagaagattaagaaaaaacaaattagtaagagat
ctagtagctgaaacgactctttttcaagacgatttagtacttccaatatttataaaggaa
agtataaatgagccagaacaaattacttcaatgccaggagtgtacagatatccaccaaat
gataagttagtcaattatgtacaagatagctatgaaaatggtattcgaagtattatattg
tttggaattccatcttataaagacgagatagcatcatcagcctacgataaaaatggtgta
atacagagggcagttaaaataataaaagatagttttaaggataagattatagtaatcaca
gacgagtgtactgatgagtatacgtctcatggtcattgcggtcttgtgaactataataac
ggatgttatgtaatagataatgatgaaagcctaaagattcatgcaaagattgcattaagc
caagctgaagctggagcagatattatagccccatcaagcatgatggacggtgttgttaag
gctataagagatgcgctagatggagctggttacaatgatacattgataatgtcatacagt
gtaaagtacgcttcaataatgtatggtccttttagggatgcggcttactctaaaccagcg
tttggagataggagagggtatcagatggatcctaggaacgcatttgaagcattaaaagaa
gctagattagatatagaggaaggagctgatattttgatggtcaaacctgcccatacatat
ttagatgtaataagattagtaaaagatcacttcccagaatatcccctagcggcatatcat
gtcagtggtgaatatagcatgataaaagcagcagcaattaatggatggatagatgaaagg
actgccgtattggaaattactaccgcaataaaaagagcaggggctgatttaattattact
tattatgctaacgatattgtaagatggataaaggaaggtgtaccattttga

DBGET integrated database retrieval system