KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1070Help
Entry
YN1551_1070       CDS       T00902                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
951484..952110
Genome map
AA seq 208 aa AA seqDB search
MQKTELDDQKLVEEIARRIREILELLGENPEREGLKETPERVAKALLEMTSGLRTPPPQI
KVFSLGEDGEAYEKNQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNSGKVAGFSKIIR
IVNYYSSRLQIQERLVEQIADAIMNSEIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVA
YRGLFKTNRALQNHVFRLLDNANKVNLL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacagaattagatgaccaaaaactagtagaagaaatagctagaaggattaga
gaaattctcgaactactgggtgagaatccagaaagagaagggcttaaagagacacctgaa
agagtagcaaaggctttattagaaatgacctcagggttgagaacgccaccccctcaaata
aaggtattcagtttaggcgaagatggtgaagcatacgaaaagaaccaaatagtattaata
aaagacgttaacttttcgtcattgtgtgagcatcatatgttgccaataattggaaaaatt
catgtagcgtacattgttagtaatagtggcaaggttgctggttttagcaaaataattaga
attgtaaattattactcatctcgtcttcaaattcaagagaggttagtagagcaaatagct
gatgctataatgaatagcgaaataaaacctaaaggtgttatggtgatcgggaacgcaata
catatgtgttcatatgtcagaggagtaaaggataaagaggccaagttagtttcagtagca
tacagagggctgtttaagactaatagagctttacaaaatcatgtcttcaggttactcgat
aatgcaaataaggtaaacttattatag

DBGET integrated database retrieval system