KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1149Help
Entry
YN1551_1149       CDS       T00902                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sin00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1025093..1025986
Genome map
AA seq 297 aa AA seqDB search
MSDGRLLYLNENSRKFAGFNKERSPFVIIGIPMDITSSYRPGSRFAPSSIRESAQYIEFY
SIRNDVDMGEIGFNDVGDIILHPSNVEENISRISSVINYFHENGKITISIGGEHTITAGV
IKGMKREGLCLVSFDAHLDLRDEYMGYRYDHACVIRRISEYGVKIIEVGTRAVSKEEIEY
ARQKGIAFFTPQQVRLLGVKETSRRIITSIQECKSLYISVDMDGIDPAYAPAVATPEPDG
LDPSTLLDIINLIADKRVIGFDVVEVSPSYDTSGITSVLASRIILEIAATVYKSRLL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacggaagattactttatttaaatgagaatagtaggaaatttgctggatttaac
aaggaaagatcaccctttgtaataattggaatacccatggacattacaagtagctatagg
ccaggaagtagatttgctccatcttcaataagagaatcagctcaatatattgaattttat
tcaataaggaatgatgtggatatgggcgaaataggtttcaatgatgtaggtgatataatt
ctacacccttcaaacgttgaggagaacataagtaggatatcaagtgtgataaattatttc
cacgaaaacgggaaaattactatttccataggtggggagcacacgataactgcgggagtg
ataaaaggaatgaaaagggaaggattatgtttagtcagttttgatgcacatttagattta
agagatgaatacatgggatacagatacgatcacgcttgtgttataaggaggatatctgaa
tatggcgtcaaaattattgaagtggggactagggcagttagtaaggaggaaatagaatac
gctagacaaaaggggatagcattttttacacctcagcaagttagacttttaggggttaag
gagacttcaagaagaataattacctcaatacaagaatgtaaatcactctatatctcagtt
gatatggatgggatagatccagcttacgcaccagctgttgcaacaccagagccagatgga
ttagacccatctactttattggatataattaacttaattgcagataaaagagttatagga
tttgatgttgtggaagtttctccttcttatgacacttcaggtataactagtgtactagct
tctagaataattctggaaatcgctgcaacggtttataagtctagattgctttaa

DBGET integrated database retrieval system